Recombinant Mouse Anti-B. melitensis omp31 Antibody (A59/10F09/G1O)
This product is a mouse monoclonal antibody that specifically recognizes NAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFV, which is an linear epitope on 31 kDa outer-membrane protein from Brucella melitensis. The omp31-binding antibody A59/10F09/G1O is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1073LC |
| Pricing | Inquiry |
| Host | Mouse |
| Target | omp31 |
| Species Reactivity | B. melitensis |
| Type | IgG2a |
| Applications | Western Blot |