Recombinant Mouse Anti-P. falciparum MSP-1 Antibody (5B1)
This product is a mouse monoclonal antibody that specifically recognizes NISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT, which is an linear epitope on Merozoite surface protein 1 from Plasmodium falciparum. The MSP-1-binding antibody 5B1 is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1325LC |
| Pricing | Inquiry |
| Host | Mouse |
| Target | MSP-1 |
| Species Reactivity | P. falciparum |
| Type | IgG |
| Applications | Western Blot |