Recombinant Mouse Anti-BTV-1 VP7 Antibody (20A11)
This product is a mouse monoclonal antibody that specifically recognizes GVTVSVGGVDMRAGRIIAWDGQAALQIHNPTQQN, which is an linear epitope on Core protein VP7 from Bluetongue virus-1. The VP7-binding antibody 20A11 is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1515LC |
| Pricing | Inquiry |
| Applications | Western Blot |
| Host | Mouse |
| Target | VP7 |
| Species Reactivity | BTV-1 |