| Supplier |
Creative Peptides |
| Product # |
R1943 |
| Pricing |
Inquire
|
| Synonyms |
MEDI 0382 acetate; MEDI-0382 acetate; MEDI0382 acetate
|
| MolecularFormula |
C169H256N42O57
|
| MolecularWeight |
3788.14
|
| Sequence |
- One Letter Code: 1'-{palmtoyl-Glu}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG (Amide bridge: Glu1'-Lys10)
- Three Letter Code: 1'-{palmtoyl-Glu}; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Lys-Ser-Glu-Tyr-Leu-Asp-Ser-Glu-Arg-Ala-Arg-Asp-Phe-Val-Ala-Trp-Leu-Glu-Ala-Gly-Gly (Amide bridge: Glu1'-Lys10)
|
| Storage |
Store at -20°C
|
| Explanation |
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate (MEDI0382 acetate) exhibits ability to facilitate both weight loss and glycaemic control, has the potential for obesity and type 2 diabetes (T2D) treatment.
|
| Activity |
Agonist
|
| Solubility |
DMSO: 2 mg/mL (0.53 mM); H2O: < 0.1 mg/mL (insoluble)
|
| BiologicalActivity |
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively.
|
| Reference |
1. Henderson SJ,et al. Robust anti-obesity and metabolic effects of a dual GLP-1/glucagon receptor peptide agonist in rodents and non-human primates.Diabetes Obes Metab. 2016 Dec;18(12):1176-1190.
|