Recombinant Mouse Anti-B. melitensis BP26 Antibody (V78/10A07/H09)
This product is a mouse monoclonal antibody that specifically recognizes TMLAAAPDNSVPIAAGENSYNVSVNVVFEIK, which is an linear epitope on 28 kDa Cytosoluble protein from Brucella melitensis. The BP26-binding antibody V78/10A07/H09 is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1023LC |
| Pricing | Inquiry |
| Applications | Western Blot |
| Host | Mouse |
| Target | BP26 |
| Species Reactivity | B. melitensis |