Recombinant Human Anti-HTLV-1 Env Antibody (PRH-1)
This product is a human monoclonal antibody that specifically recognizes LALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLI, which is an linear epitope on Envelope protein from Human T-lymphotropic virus 1. The Env-binding antibody PRH-1 is an epitope-specific antibody that can be used in ELISA.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1677LC |
| Pricing | Inquiry |
| Host | Human |
| Target | Env |
| Species Reactivity | HTLV 1 |
| Type | IgG1 |
| Applications | Enzyme-linked Immunosorbent Assay |