EGF, rat recombinant
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coliis a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.
| Supplier | CD BioSciences |
|---|---|
| Product # | APE-017 |
| Pricing | , Inquire |
| Product Category | Proteins/Enzymes |
| Gene ID | 6075 |
| Alternate Name | Urogastrone, URG, EGF, epidermal growth factor |
| Molecular Weight | 6.151 kDa |
| Appearance | Lyophilized protein |
| Storage Conditions | -20°C |
| Gene Symbol | EGF |
| Source | E. coli |
| Physical Form Description | Lyophilized from PBS, pH 7.4 |
| Purity by SDS-PAGE | ≥98% |
| Amino Acid Sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |