| Supplier |
Creative Peptides |
| Product # |
10-101-171 |
| CAS # |
118812-69-4 |
| Pricing |
Inquire
|
| LabelingTarget |
Atrial natriuretic peptide receptor
|
| Synonyms |
Urodilatin;ularitide
|
| MolecularFormula |
C145H234N52O44S3
|
| MolecularWeight |
3505.92646
|
| Source |
Synthetic
|
| Sequence |
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge cys11 and cys27)
|
| Storage |
-20°C
|
| Explanation |
Ularitide is a synthetic form of urodilatin, a naturally occurring human natriuretic peptide that is involved in regulating blood pressure and the excretion of water and sodium from the kidneys. Urodilatin is produced in the kidney and excreted into the urine, and thus exists in low levels naturally in the systemic blood circulation. When injected into the blood, ularitide appears to cause diuresis (urine output) and natriuresis (sodium excretion), as well as vasodilation.
|
| Application |
Ularitide is investigated for use in congestive heart failure.
|
| AreasOfInterest |
Cardiovascular System & Diseases
|
| Functions |
Protein kinase activity
|
| Disease |
Congestive heart failure
|
| Organism |
Human
|