Recombinant Mouse Anti-C. botulinum botE Antibody (EK19-7)
This product is a mouse monoclonal antibody that specifically recognizes KNELTNKYDIKQIENELNQKVSIAMNNIDRFLTESSISYLMKIINEVKINKLREYDE, which is an linear epitope on Botulinum neurotoxin type E from Clostridium botulinum. The botE-binding antibody EK19-7 is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1270LC |
| Pricing | Inquiry |
| Applications | Western Blot |
| Host | Mouse |
| Target | botE |
| Species Reactivity | C. botulinum |