Recombinant Human Anti-C5AR1 Antibody
This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1006LC |
| Pricing | Inquiry |
| Host | Human |
| Target | C5AR1 |
| Species Reactivity | Human |
| Type | IgG |
| Applications | Blocking |