Recombinant Mouse Anti-B. melitensis omp2b Antibody (A68)
This product is a mouse monoclonal antibody that specifically recognizes VIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQNYGQWG, which is an linear epitope on Porin Omp2b from Brucella melitensis. The omp2b-binding antibody A68 is an epitope-specific antibody that can be used in ELISA.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1287LC |
| Pricing | Inquiry |
| Applications | Enzyme-linked Immunosorbent Assay |
| Host | Mouse |
| Target | omp2b |
| Species Reactivity | B. melitensis |