Recombinant Llama Anti-PTH Single Domain Antibody (PTH50)
Parathyroid hormone (PTH) and its related peptides (PTHrP) are used to treat osteoporosis. High affinity and high specific antibodies are required to estimate the blood PTH level to guide the treatment. An single domain antibody, PTH50, is provided against a PTHrP, PTH2 (SVSEIQLMHNLGKHLNSMERVEWLRKLLQVD).
| Supplier | Creative Biolabs |
|---|---|
| Product # | FAMAB-0322YC-VHH |
| Pricing | Inquiry |
| Host | Llama |
| Target | PTH (Parathyroid hormone) |
| Species Reactivity | Human |
| Type | Llama VHH |
| Applications | ELISA |
| Storage | Store at -20°C for long-term storage. Avoid freeze/thaw cycles. |