-
No products found
because this supplier's products are not listed.
Jiefu Jin, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... A recombinant anti-FAP-α monoclonal rabbit antibody ab207178 (clone EPR20021, abcam) was used to probe human/murine FAP-α ...
-
No products found
because this supplier's products are not listed.
Jiechao Zhou, et al.,
bioRxiv - Neuroscience 2022
Quote:
... or DIV12 neurons in the presence of recombinant protein (see recombinant protein below) or C1q-blocking antibody (Recombinant Anti-C1q antibody (ab182451)) / IgG (Normal Rabbit IgG,Cell Signaling Technology). For LPS induced activation of microglia ...
-
No products found
because this supplier's products are not listed.
Whee-Soo Kim, et al.,
bioRxiv - Biochemistry 2022
Quote:
... and rabbit anti-albumin (ALB, Sigma-Aldrich). The following secondary antibodies were used ...
-
No products found
because this supplier's products are not listed.
Emilie Puginier, et al.,
bioRxiv - Cell Biology 2024
Quote:
... rabbit recombinant ANTI-FLAG M2 antibody (Invitrogen 710662), guinea pig anti-bovine insulin (Linco ...
-
No products found
because this supplier's products are not listed.
Sara Kass-Gergi, et al.,
bioRxiv - Immunology 2024
Quote:
... APC anti-mouse CD8a Recombinant antibody (1:100, Biolegend, Clone QA17A07), PE anti-mouse Ly-6G antibody (1:200 ...
-
No products found
because this supplier's products are not listed.
Jose Maria Aguilar-Camacho, et al.,
bioRxiv - Evolutionary Biology 2022
Quote:
... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
No products found
because this supplier's products are not listed.
Tal Noy-Porat, et al.,
bioRxiv - Immunology 2020
Quote:
... ELISA of both sera and recombinant scFv-Fc human antibodies applied with AP-conjugated anti-human IgG (Jackson ImmunoResearch, USA) following detection using PNPP substrate (Sigma ...
-
No products found
because this supplier's products are not listed.
M. Alessandra Vigano, et al.,
bioRxiv - Cell Biology 2020
Quote:
The anti-GCN4-scFv was generated from pHR-scFv-GCN4-sfGFP-GB1-dWPRE (Addgene plasmid 60907 (Tanenbaum et al., 2014), cut with EcoRI/XbaI and inserted into pcDNA3 ...
-
No products found
because this supplier's products are not listed.
Kenta Ite, et al.,
bioRxiv - Cell Biology 2023
Quote:
... albumin (ALB) (Dako Omnis), and AE1/AE3 (712811 ...
-
No products found
because this supplier's products are not listed.
Kevin Emmerich, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti-Caspase-3 monoclonal antibody (1:500, clone C92-605; BD Biosciences), Click-iT Tunel Alexa Fluor 647 (1:500 ...
-
No products found
because this supplier's products are not listed.
Anastasia-Maria Zavitsanou, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... anti-CD8a antibodies (clone: 2.43, Bioxcell) and anti-CD4 (GK1.5 ...
-
No products found
because this supplier's products are not listed.
Quynh T. Phan, et al.,
bioRxiv - Microbiology 2021
Quote:
... The antibodies used were rabbit anti-EGFR (Genetex; # GTX121919, clone N1-2), mouse anti-EGFR (Santa Cruz Biotechnology # SC-101 ...
-
No products found
because this supplier's products are not listed.
So Nakagawa, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... an anti-human ERV3 antibody (rabbit polyclonal clone; Santa Cruz Biotechnology, CA), as a primary antibody ...
-
No products found
because this supplier's products are not listed.
Eddie Grinman, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Anti-DIG fab fragment antibody (Roche) was used at a concentration of 1:4000 ...
-
No products found
because this supplier's products are not listed.
Jun Yang, et al.,
bioRxiv - Cell Biology 2024
Quote:
... including anti-Alb (Proteintech, Wuhan, China, #66051-1-Ig, 1:200), anti-Mecp2 (CST ...
-
No products found
because this supplier's products are not listed.
Miriam T. Kastlmeier, et al.,
bioRxiv - Cell Biology 2023
Quote:
... and Albumin (ALB, R&D Systems). NKX2.1GFP+ lung progenitor cells were enriched by GFP signal for NKX2.1 based on a previously described protocol ...
-
No products found
because this supplier's products are not listed.
Katsuhiro Tomofuji, et al.,
bioRxiv - Cell Biology 2022
Quote:
... The following primary antibodies were used: goat anti-ALB (Bethyl Laboratory, A90-134A, 1:100), rabbit anti-KRT19 (Abcam ...
-
No products found
because this supplier's products are not listed.
Dorothea Höpfner, et al.,
bioRxiv - Biochemistry 2020
Quote:
... Recombinant rabbit anti-pan-ADP-ribose binding reagent MABE1016 (Merck Millipore) was used 1:1000 ...
-
No products found
because this supplier's products are not listed.
Nuno Apóstolo, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rabbit anti-BRINP2 (Atlas Antibodies), sheep anti-CNTN1 (R&D Systems) ...
-
No products found
because this supplier's products are not listed.
Mary S Pampusch, et al.,
bioRxiv - Immunology 2021
Quote:
... sections were stained with 0.4 µg/mL rabbit -anti-human CD20 polyclonal antibodies (Neomarkers) and 2 µg/mL rat-anti-human CD3 antibodies (clone MCA1477, BioRad). Then ...
-
No products found
because this supplier's products are not listed.
Leandre M. Glendenning, et al.,
bioRxiv - Immunology 2023
Quote:
... and Alb-Cre mice (Jackson Labs, stock 003574) were crossed to produce the HcKO line ...
-
No products found
because this supplier's products are not listed.
Ruobo Zhou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rabbit anti-L1CAM antibody (ABclonal, A8555), rat anti-L1CAM antibody (R&D Systems ...
-
No products found
because this supplier's products are not listed.
Jordan J. Clark, et al.,
bioRxiv - Microbiology 2023
Quote:
... The following primary antibodies were applied: rabbit anti-human ACE2 (Novus Biologicals; clone SN0754; NBP2-67692), goat anti-IAV (Meridian Life Sciences Inc. ...
-
No products found
because this supplier's products are not listed.
Daniel Gonçalves-Carneiro, et al.,
bioRxiv - Microbiology 2020
Quote:
... anti-HA (rabbit, 1:5000, clone 600-401-384, Rockland), anti-Tubulin (mouse ...
-
No products found
because this supplier's products are not listed.
Annu Nummi, et al.,
bioRxiv - Cell Biology 2021
Quote:
... rabbit anti-CD45 IgG (clone #145 monoclonal recombinant, Sino Biological 100342-R145, Beijing, China). All antibodies were diluted using the antibody diluent (BiositeHisto ...
-
No products found
because this supplier's products are not listed.
Yutaka Sakamaki, et al.,
bioRxiv - Synthetic Biology 2022
Quote:
... or anti-rabbit antibody (GE Healthcare) as secondary antibodies ...
-
No products found
because this supplier's products are not listed.
Francesca Pinci, et al.,
bioRxiv - Immunology 2022
Quote:
... RetroNectin® Recombinant Human Fibronectin Fragment (Takara Bio, Cat#T100A), Recombinant Murine Flt3-Ligand (Peprotech ...
-
No products found
because this supplier's products are not listed.
YiQing Lü, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... anti-rabbit secondary antibodies (Vector Labs BA-1000 ...
-
No products found
because this supplier's products are not listed.
Qiqi Shi, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... and the goat anti-rabbit antibody (anti-rabbit IgG AP conjugate, Promega) as secondary antibody (30) ...
-
No products found
because this supplier's products are not listed.
Ruobo Zhou, et al.,
bioRxiv - Neuroscience 2020
Quote:
... rabbit anti-Tau antibody (Synaptic Systems, 314002), mouse anti-Kv1.2 channel antibody (Neuromab ...
-
No products found
because this supplier's products are not listed.
Kari L. Price, Dyuthi M. Tharakan, Lynn Cooley,
bioRxiv - Developmental Biology 2022
Quote:
... The following primary antibodies were used: 1:200 rabbit anti-MKLP1 (clone 7C9, Bioss Antibodies, cat. BSM-52401R) and 1:10 mouse anti-alpha Tubulin (clone 4A1 ...
-
No products found
because this supplier's products are not listed.
Andrea Toledo, et al.,
bioRxiv - Neuroscience 2021
Quote:
... and the V5 tag recombinant Fab fragment (Abnova, RAB00032) were coupled NHS-derived dyes using the same protocol as above but without the size-exclusion chromatography purification step.
-
No products found
because this supplier's products are not listed.
Deding Su, et al.,
bioRxiv - Plant Biology 2021
Quote:
... the anti-GAI rabbit antibody and goat anti-rabbit IgG antibody (Agrisera, Sweden) were used to perform immunoblot.
-
No products found
because this supplier's products are not listed.
Paula A. dos Santos Claro, et al.,
bioRxiv - Cell Biology 2022
Quote:
... anti-rabbit-IRDye680LT and anti-rabbit-IRDye800CW secondary antibodies (LI-COR Biosciences). Phosphorylated proteins were relativized to the total protein level ...
-
No products found
because this supplier's products are not listed.
Sandro Capellmann, et al.,
bioRxiv - Immunology 2023
Quote:
... Cell surface localization of FcεRI and SR-BI was determined by using FITC-labelled anti-FcεRI antibody (Clone MAR-1) and anti-SR-BI (USBiological) and PE-labelled anti-rabbit antibodies (Dianova) following blocking of FcγRs with Fc-block (BD Biosciences).
-
No products found
because this supplier's products are not listed.
Matthew D. Beasley, et al.,
bioRxiv - Immunology 2020
Quote:
Diabodies were produced from scFv clones by PCR of the VL and VH domains using Q5 DNA polymerase (NEB, Cat: M0491S) to shorten the amino acid linker between the domains to SSGGGGS ...
-
No products found
because this supplier's products are not listed.
Marie-France Martin, et al.,
bioRxiv - Microbiology 2022
Quote:
... recombinant anti-DC-SIGN (clone REA617, Miltenyi Biotec), mouse anti-CD1a (Novus Biologicals) ...
-
No products found
because this supplier's products are not listed.
A. Jane Bardwell, et al.,
bioRxiv - Cell Biology 2021
Quote:
... the antibodies used were rabbit monoclonal anti-GLI1 (Clone EPR4523, Origene Technologies) at a 1:1000 dilution and anti-Lamin A/C (Cell Signaling Technologies 2032 ...
-
No products found
because this supplier's products are not listed.
Emeric Merour, et al.,
bioRxiv - Neuroscience 2022
Quote:
... rabbit anti-H3K27Ac antibody (Active motif, 39034), rabbit anti-H3K4me1 antibody (Ozyme ...
-
No products found
because this supplier's products are not listed.
MG Booty, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... Anti-p53 rabbit polyclonal antibody (clone CM5) was purchased from Leica Biosystem (NCL-L-p53-CM5p ...
-
No products found
because this supplier's products are not listed.
Siyu Chen, et al.,
bioRxiv - Microbiology 2022
Quote:
... goat anti-rabbit and rabbit anti-goat antibodies (SouthernBiotech) were used as secondary antibodies with a dilution of 1:2,000.
-
No products found
because this supplier's products are not listed.
Karsten Eichholz, et al.,
bioRxiv - Immunology 2021
Quote:
... recombinant protein and anti-CD14 antibody (Beckman) were used at 20 μg/ml ...
-
No products found
because this supplier's products are not listed.
Kalliopi Skamaki, et al.,
bioRxiv - Biochemistry 2020
Quote:
scFv-ribosome-mRNA complexes were subjected to selection in solution using recombinant biotinylated human IL-13 (Peprotech) to allow capture using streptavidin-coated paramagnetic beads (Dynabeads M-280) ...
-
No products found
because this supplier's products are not listed.
Zhen Wang, et al.,
bioRxiv - Genomics 2020
Quote:
... the anti-m5C antibody clone ICC/IF (Diagenode) was added to the flow cell at a 1:500 dilution in ABB6 buffer.
-
No products found
because this supplier's products are not listed.
Lucas AB Fisher, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Rabbit anti-GFP antibody (Chromotek) was then added at a 1:5000 dilution concentration ...
-
No products found
because this supplier's products are not listed.
Megan K. Elder, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Slices were incubated overnight at 4°C in rabbit anti-amyloid beta antibody (1:200; clone 6E10, Enzo Life Sciences), followed by Alexa-488-labelled goat anti-rabbit secondary antibody (1:500 ...
-
No products found
because this supplier's products are not listed.
Andy Q. Yuan, et al.,
bioRxiv - Immunology 2020
Quote:
... Amplified scFv PCR fragments were purified with Gel Extraction kit (Qiaquick Gel Extraction Kit, Cat# 28706, QIAGEN), and subjected to SfiI (Fast Digest SfiI ...
-
No products found
because this supplier's products are not listed.
Hua Tian, et al.,
bioRxiv - Cell Biology 2022
Quote:
... ALB was stained with Opal 520 Reagent (Perkin Elmer, FP1487001KT), GLUL was stained with Opal 570 Reagent (Perkin Elmer ...
-
No products found
because this supplier's products are not listed.
Peter Jan Hooikaas, et al.,
bioRxiv - Cell Biology 2020
Quote:
... and the following mouse monoclonal antibodies: anti-CD3 (Clone UCHT1, StemCell Technologies, #60011) and anti-Ku80 (BD Bioscience ...
-
No products found
because this supplier's products are not listed.
Yijun Gui, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Primary antibodies (rabbit anti-cFos, Cell Signaling Technology, 1:500; chicken anti-GFP, Aves Labs, 1:1500) diluted in blocking buffer were added to sections overnight at room temp ...