Labshake search
Citations for GenScript :
1 - 50 of 616 citations for Tripartite Motif Containing 22 TRIM22 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: The synthetic peptides containing the 8-residue long LC8 binding motifs were ordered from Genscript Ltd ...
-
bioRxiv - Biochemistry 2020Quote: A custom-made mouse monoclonal antibody against the isoDGR motif was prepared by GenScript Corporation (Piscataway ...
-
bioRxiv - Neuroscience 2020Quote: ... Bam8-22 (custom synthesized by Genscript), histamine (Sigma H7250) ...
-
bioRxiv - Microbiology 2022Quote: ... or proximal Rex + PerR motifs were constructed by Genscript (Piscataway, NJ) in the EcoRV site of pUC57 ...
-
bioRxiv - Biochemistry 2021Quote: Peptide synthesis of WT and mutant PLN8-22 was performed by Genscript Biotech Corporation ...
-
bioRxiv - Immunology 2020Quote: ... only 22 peptides were successful in the synthesis with 90% purity (Genscript USA) and were used for further analysis as previously described[17].
-
bioRxiv - Biophysics 2023Quote: ... were used as described previously.22 These substrates were custom synthesised by GenScript, NJ ...
-
bioRxiv - Immunology 2023Quote: ... supernatants containing monoclonal antibodies were purified using Protein A magnetic beads (Genscript), and the purified samples were verified by SDS-PAGE.
-
bioRxiv - Immunology 2024Quote: ... tEGFR and ΔFAS sequences were separated by P2A motifs and synthesized by Genscript. The synthesized genes were subcloned into a SFG88 retroviral vector and the identity of the new sequences was confirmed by Sanger sequencing (Genscript) ...
-
bioRxiv - Immunology 2023Quote: ... supernatants containing the monoclonal antibodies were purified using protein A magnetic beads (Genscript, L00695). The purified samples were determined by SDS-PAGE.
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Microbiology 2020Quote: ... The BH3-motif peptides used were commercially synthesized and were purified to a final purity of 95% (GenScript) and based on the human sequences previously described [26] except for Bok BH3 ...
-
bioRxiv - Microbiology 2020Quote: ... The BH3-motif peptides used were commercially synthesized and were purified to a final purity of 95% (GenScript) and based on the human sequences as previously described [57].
-
bioRxiv - Molecular Biology 2023Quote: ... basic coil motif (AQCKKKLQALKKKNAQLKWKLQALKKKLAQ) and 6xHIS tag inserted into a pcDNA3.1-Hygro(-)-like backbone was synthesized commercially (GenScript). The region encoding the α4 ectodomain (M1-Q970 ...
-
bioRxiv - Immunology 2021Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (Genscript) and used to transfect Expi293 cells (ThermoFisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: Antibody heavy chain and light chain genes were synthesized and cloned into plasmids containing the CMV promoter (GenScript). Final heavy and light chain plasmids were amplified ...
-
bioRxiv - Immunology 2023Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (GenScript) and transfected into Expi293 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Biophysics 2021Quote: A plasmid expressing mature OmpA without the 22 amino acid signal sequence in the pET303 vector was purchased from Genscript for cloning of the modified loop constructs ...
-
bioRxiv - Synthetic Biology 2020Quote: ... pSensor09 was constructed by amplifying the backbone plasmid p416TEF1 using primer pair pYDA05/20 and primer pair pYDA21/22 to amplify PTEF1-YAS3-TCYC1 (Genscript_003).
-
bioRxiv - Molecular Biology 2024Quote: ... HA) (E1), HPV16 E2, pGL3 Basic, pGL3 Control, ptk6E2 (22, 68, 69) E2-K mutant plasmids were generated by GenScript.
-
bioRxiv - Biophysics 2021Quote: Peptides corresponding to individual E1A or E2F2 binding motifs were synthesized by FMoc chemistry at >95% purity (GenScript, USA) and quantified by Absorbance at 280 nm or by quantitation of peptide bonds at 220 nm in HCl -when Tryptophan or Tyrosine residues were absent ...
-
bioRxiv - Molecular Biology 2023Quote: ... acidic coil motif (AQCEKELQALEKENAQLEWELQALEKELAQ) and Strep-Tag II (WSHPQFEK*) inserted into a pcDNA3.1-Hygro(-)-like backbone was synthesized commercially (GenScript). The R177G/R178G ...
-
bioRxiv - Biochemistry 2022Quote: ... four copies of inhibitory peptide or control peptide with mutated binding motif spaced out by a flexible GST linker and fused to C-terminus of EGFP were ordered from GenScript. At 72 h post transfection ...
-
bioRxiv - Immunology 2022Quote: ... Matched pairs of antibody VH and Vλ/Vκ sequences were commercially cloned into plasmids containing an IgG1 or relevant light chain backbone and expressed as recombinant antibody (Genscript). mAbs were also expressed in-house by transient transfection of Expi293 cells (Gibco ...
-
bioRxiv - Cancer Biology 2020Quote: The ORFeome library was then generated via insert synthesis and cloning of unique plasmid inserts consisting unique barcodes (Supplementary Table 22) by a commercial vendor (GenScript, Piscataway, NJ) in arrayed barcoded tube format ...
-
bioRxiv - Microbiology 2021Quote: ... pH 7.5) containing 3 % (w/v) skim milk powder and incubated with a rabbit anti-SLPMh 133-147 primary antibody (GenScript, Leiden, Netherlands), diluted 1:200 in TBS (10 mM TRIS ...
-
bioRxiv - Cell Biology 2023Quote: Samples containing 1.2X Sample Buffer (Genscript) were separated via SDS-PAGE using 4- 12% Bis-Tris (Genscript ...
-
bioRxiv - Developmental Biology 2023Quote: ... Wild type or a mutant version of the human PDX1 enhancer with 6 CisBP predicted RFX binding motifs mutated (Weirach et al 2014) were commercially synthesized by Genscript (Genscript USA, Piscataway, NJ) and cloned into the pGL4.23 firefly luc2/miniP vector (Promega E8411) ...
-
bioRxiv - Neuroscience 2023Quote: Crf containing clone was acquired from GenScript, but the vector (pcDNA3.1-C-(k)DYK ...
-
bioRxiv - Genetics 2023Quote: ... A plasmid containing mouse Pax1 (GenScript; OMu21524) was used as template for DIG-labeled probes ...
-
bioRxiv - Biochemistry 2023Quote: ... transferred into tubes containing FLAG resin (GenScript), and rotated for 2 hrs at 4°C ...
-
bioRxiv - Biochemistry 2020Quote: Plasmids containing target genes were synthesized by Genscript Biotech and PCR-amplified by 30 cycles of denaturing (95 °C for 30 s) ...
-
bioRxiv - Biochemistry 2021Quote: ... elution buffer containing 200 µg/mL DYKDDDDK peptide (Genscript) was added to samples and incubated with shaking 2X for 30 minutes each (eluates were collected after each incubation) ...
-
bioRxiv - Genomics 2023Quote: ... plasmids containing wild type ORFs were obtained from GenScript. The ORFs were cloned into the pcDNA3.1(- ...
-
bioRxiv - Cancer Biology 2020Quote: ... 0.02% [v/v] Brij-35) containing 200 µM CaMKKtide (Genscript), 100 µM CaCl2 ...
-
bioRxiv - Cancer Biology 2022Quote: ... 0.02% [v/v] Brij-35) containing 200 μM CaMKKtide (Genscript), 100 μM CaCl2 ...
-
bioRxiv - Cancer Biology 2023Quote: ... containing the TP53::ROR2 fusion was constructed (GenScript, Piscataway, NJ). The TP53 promoter was represented by the first 2000 bp upstream of TP53 together with exon 1 and the first 500 bp of intron 1 of TP53 ...
-
bioRxiv - Microbiology 2022Quote: ... or mouse anti-FLAG antibody (anti-DYKDDDDK antibody, Genscript) with Pierce ECL Western Blotting Substrate (Thermo Fisher Scientific).
-
bioRxiv - Plant Biology 2020Quote: ... intron containing gene was chemically synthesized (GenScript, Piscataway Township, New Jersey) and cloned between BamHI-BglII or Eco32I-EcoRI in the pOpt2_mVenus_Paro vector (Wichmann et al. ...
-
bioRxiv - Bioengineering 2021Quote: ... Codon-optimized cDNAs containing the effector protein RfxCas13d were synthesized (Genscript) and assembled into modified pET28 vectors by NEBuilder HiFi DNA assembly (E2621 ...
-
bioRxiv - Cell Biology 2019Quote: ... More complex mutants containing multiple nucleotide exchanges were commercially synthesized (GenScript). All coding sequences were either available as Gateway entry vectors or subcloned into pDONR or pENTR vectors using the Gateway technology (LifeTechnologies) ...
-
bioRxiv - Developmental Biology 2021Quote: Plasmids containing cDNA for OPN1MW and OPN1LW were purchased from GenScript: NM_000513.2 (OPN1MW ...
-
bioRxiv - Biochemistry 2020Quote: ... containing a TEV protease cleavage site and a His6 tag (Genscript). All constructs were verified with DNA sequencing of both strands.
-
bioRxiv - Genomics 2020Quote: ... was reacted with a thiol-containing adhesive peptide GRGDSPC (Genscript, RP20283) in PBS with 4 mM TEA at pH 7.4 for 1 hour ...
-
bioRxiv - Molecular Biology 2023Quote: ... Peptides containing an N-terminal biotin tag were purchased from GenScript and dissolved according to manufacturer’s recommendation ...
-
bioRxiv - Neuroscience 2023Quote: ... were reacted with equimolar cell-degradable peptide containing sequence KCGPQGIWGQCK (GenScript), 3.0 mM CRGDS basement membrane-mimicking peptide (GenScript) ...
-
bioRxiv - Developmental Biology 2023Quote: ... was reacted with a thiol-containing adhesive peptide GRGDSPC (Genscript, RP20283) in PBS with 20 mM HEPES at pH 7.4 for 1 hour ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... anti-cGMP antibody (PerkinElmer anti-cGMP antibody: final dilution1:8000, Genscript anti-cGMP antibody ...
-
bioRxiv - Immunology 2020Quote: ... Commercial antibodies tested also included a human IgG chimeric antibody from GenScript (SARS-CoV-2 spike S1 Antibody (HC2001), GenScript #A02038 ...
-
bioRxiv - Plant Biology 2022Quote: ... a DNA fragment containing two expression cassettes was synthesized artificially (GenScript, China): one was for the plasma-membrane-targeted mTagBFP2-FRB and the other was for the ICR1- or ICR2-fused mCherry-FKBP12 (Fig ...