Labshake search
Citations for GenScript :
1 - 50 of 114 citations for Toxoplasma gondii IgG antigen RH strain since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... or the Toxoplasma specific peptides AS15 and ROP5 (custom made, Genscript) for 4 hours ...
-
bioRxiv - Cell Biology 2023Quote: ... K916R mutant of the Rubicon RH domain was synthesized by Genscript in a pMAL-c5E vector.
-
bioRxiv - Biophysics 2020Quote: ... To determine the binding affinities between antigens and antibody mouse monoclonal anti-His-tag IgG (clone 6G2A9, The™ His tag Ab, GenScript) was captured on the surface of active flow cell to the level of 100-200 RU ...
-
bioRxiv - Biophysics 2020Quote: The Rh-PDE (full) gene (NCBI Gene ID: 16078606) was synthesized after human codon optimization (GenScript), as described previously13 ...
-
bioRxiv - Evolutionary Biology 2024Quote: The gene sequences of the Vibrio astriarenae strain (HN897) strain were synthesized by Genscript, named Vsp6 ...
-
bioRxiv - Microbiology 2020Quote: Commercially produced purified antigens were supplied by GenScript as follows ...
-
bioRxiv - Molecular Biology 2020Quote: ... The antigen coding sequence was synthesized by GenScript to reflect the preferred human codon usage and synthetic restriction sites were added to the 5’ (HindIII and AgeI ...
-
bioRxiv - Cancer Biology 2021Quote: ... the melanoma cells were spiked with gp100+ antigens (GenScript) just before addition of T-cells ...
-
bioRxiv - Microbiology 2022Quote: ... and polyclonal αcGAS antibodies were purified by antigen affinity (GenScript). Serum was used at 1:30,000 for cGAS detection ...
-
bioRxiv - Immunology 2022Quote: ... 5 μl synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), or 5 μl heat-killed bacteria in PBS ...
-
bioRxiv - Immunology 2020Quote: ... The multiplex antigen panel was completed with commercial S1 (GenScript Biotech, Netherlands) and S2 (Sino Biologicals ...
-
bioRxiv - Immunology 2022Quote: ... 5 μl of a synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), eBioscience Cell Stimulation Cocktail (Fisher Scientific 00-4975-93 ...
-
bioRxiv - Developmental Biology 2020Quote: ... Antigen for the custom anti-Nrl antibody (commissioned from Genscript, Piscataway, NJ, USA) was recombinant protein matching the C-terminal 112 amino acids of zebrafish Nrl (residues 301-412 of GenBank ...
-
bioRxiv - Plant Biology 2019Quote: ... 1:500 (produced for this study using full length protein as antigen by GenScript); α-Actin ...
-
bioRxiv - Microbiology 2020Quote: ... EsxA and SodA were generated for this study (Customer’s Antigen Polyclonal Antibody Package, Genscript). C-terminally his6-tagged SiEsaA41-871 ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... All plasmids and strain construction were confirmed by Sanger sequencing (Genscript).
-
bioRxiv - Microbiology 2022Quote: ... was synthesized based on MARV strain Musoke (GenBank: DQ217792) by GenScript Biotech ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2023Quote: ... or 9 ug/mL of full-length FimH protein (antigen for custom antibody production, Genscript) was used.
-
bioRxiv - Microbiology 2022Quote: ... Rabbit IgG Control (GenScript).
-
bioRxiv - Microbiology 2021Quote: ... Mouse anti-CodY IgG monoclonal antibody (IgG) was generated and purified (Genscript, USA).
-
bioRxiv - Biochemistry 2023Quote: ... coli strain BL21 (DE3) cells and purified by Ni-NTA chromatography (GenScript).
-
bioRxiv - Immunology 2023Quote: ... coli (strain K12) TolC gene (Uniprot P02930) was synthesized by GenScript (USA) and inserted into a pET30a vector ...
-
bioRxiv - Immunology 2024Quote: ... or IgG (Cat #A01008, GenScript) were added and beads were rotated at 4°C for 5 hr ...
-
bioRxiv - Biochemistry 2020Quote: ... strains were arrested in G1 with 100 ng ml-1 alpha factor (GenScript) and incubation was continued for 3 hours ...
-
bioRxiv - Cell Biology 2022Quote: ... ferritin L (Ft-L) made by using purified human ferritin L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Microbiology 2020Quote: A codon optimized MV-H gene (Edmonston B strain) was gene synthesized by GenScript. PCR amplification of the coding region of MV-H from the plasmid was performed using primers coMV-H61 N HA FWD (5’-TCGTGGTGCCAGATCTCACAGAGCCGCCATCTAT - 3’ ...
-
bioRxiv - Molecular Biology 2019Quote: ... rabbit anti-RFP IgG (A00682, GenScript), mouse anti-PCNA IgG (Abcam ab29) ...
-
bioRxiv - Molecular Biology 2020Quote: ... Polyreactivity was quantified by detecting bound IgG using an HRP-conjugated anti-human IgG secondary antibody (Genscript) and SuperSignal ELISA Femto Maxiumum Sensitivity Substrate (Thermo Scientific) ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... we used custom polyclonal antibodies raised against recombinant fragment antigens generated by rabbits’ immunization (GenScript, Piscataway Township, NJ, USA). Each recombinant fragment was injected into three rabbits ...
-
bioRxiv - Microbiology 2021Quote: ... haemolyticus strain PK-01 chromosome (NCBI Accession: CP035541 Region: 2,573,055-2,573,114) and synthesized by GenScript Biotech Co ...
-
bioRxiv - Immunology 2022Quote: ... An hMPV F B2 (strain TN99-419) version of this construct was synthesized by GenScript. Protein expression was carried out using FreeStyle 293F cells (ThermoFisher ...
-
bioRxiv - Plant Biology 2020Quote: ... The protein was purified using GST-tag affinity and used directly as an antigen in rabbits (Genscript, Piscataway, NJ, USA). The resulting antiserum was used at a dilution of 1:30.000 ...
-
bioRxiv - Plant Biology 2022Quote: ... the gels were firstly analyzed through immunoblotting with anti-PDR6 antibody (prepared with peptide CTVVEEGKDKHKGSH as antigen by GenScript, China) and a horseradish peroxidase-conjugated antirabbit IgG secondary antibody (Beyotime Biotechnology ...
-
bioRxiv - Cell Biology 2022Quote: ... The primary antibody against Ft-L was made using recombinant human Ft-L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Immunology 2020Quote: ... The Pmel-1 melanoma antigen-derived peptide mgp10025-33 (EGSRNQDWL) (32) was custom synthesized by GenScript (Scotch Plains, NJ, USA) to more than 80% purity ...
-
bioRxiv - Immunology 2023Quote: ... 96-well plates were coated with 2 μg/mL of recombinant Karp type-specific antigen 56 (TSA56, generated by Genscript) in PBS and blocked with 1% BSA ...
-
bioRxiv - Neuroscience 2023Quote: ... while the Copiagag antibodies were generated against a Copia peptide antigen (see Figure 1) by immunizing rabbits with the peptide LMVVKNSENQLADIC (GenScript).
-
bioRxiv - Neuroscience 2023Quote: Custom rabbit polyclonal antibodies recognising CG2233 were generated using PolyExpressTM Premium antigen-specific affinity purified pAb package provided by GenScript. Antibodies were generated against recombinant CG2233 that lacks its N-terminal signal sequence (MFSINAVILGILVTSVMA ...
-
bioRxiv - Microbiology 2023Quote: ... The membrane was washed three times with goat anti-rabbit IgG antibody or goat anti-mouse IgG antibody (GenScript) for one hour followed by washing three times with TBST again ...
-
bioRxiv - Cell Biology 2021Quote: ... fap42 and fap246 strains were separated on a 4–12% gradient SDS-polyacrylamide gel (Genscript Biotech). After the dye front migrated on the gel for 3.0–3.5 cm ...
-
bioRxiv - Immunology 2021Quote: ... Antigens included recombinant SARS-CoV−2 RBD protein obtained from the Saphire laboratory at LJI or recombinant nucleocapsid protein (GenScript Z03488). The next day ...
-
bioRxiv - Immunology 2021Quote: ... A blank consisting of the blocking buffer and a standard curve ranging from 5000 pg/mL to 78.25 pg/mL of S1 antigen (GenScript, Cat# Z03501) in blocking buffer were also added in duplicates on the plate followed by incubation at room temperature for 1 hour ...
-
bioRxiv - Plant Biology 2021Quote: ... Anti-human IgG peroxidase conjugated (A00166, GenScript, USA) or anti-mouse IgG peroxidase conjugated (A4416 ...
-
bioRxiv - Immunology 2020Quote: ... or corresponding species-appropriate IgG control antibody (GenScript), conjugated to Protein A Dynabeads (Invitrogen) ...
-
bioRxiv - Immunology 2022Quote: ... Human codon-optimized cDNA encoding SARS-CoV-2 spike glycoproteins of various strains were synthesized by GenScript and cloned into eukaryotic cell expression vector pcDNA 3.1 between the BamHI and XhoI sites ...
-
bioRxiv - Biochemistry 2022Quote: ... aureus strain COL was synthesized and codon-usage was optimized for expression in Escherichia coli by GenScript USA Inc ...
-
bioRxiv - Bioengineering 2023Quote: ... plantarum NCIMB8826 strain harboring helper plasmid pLH01 was induced with 100 ng/ml Sakain P peptide (GenScript) for RecE/T expression and was subsequently prepared as competent cells ...
-
bioRxiv - Microbiology 2020Quote: A codon optimized Zika prME-NS1 gene (strain PRVABC59 Asian 2015; GenBank: ANW07476.1) was gene synthesized by GenScript. The recombinant ZIKV-NS1 was constructed as published previously (13) ...
-
bioRxiv - Microbiology 2022Quote: ... plantarum strain harboring helper plasmid pLH01 was induced with 100 ng/ml Sakain P peptide (GenScript, Piscataway, NJ) to express RecE/T and made electrocompetent ...