Labshake search
Citations for GenScript :
1 - 50 of 523 citations for Tetanus Toxoid Recombinant Heavy Chain Fragment C since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... Heavy chain and light chain plasmids were obtained from GenScript. Expi293 cells (Life Technologies ...
-
bioRxiv - Microbiology 2022Quote: ... heavy chain variable (VH) and light chain variable (VL) genes were synthesized (GenScript), cloned into an expression vector ...
-
bioRxiv - Microbiology 2021Quote: ... by synthesis of heavy chain variable (VH) and light chain variable (VL) genes (GenScript), transfection of Expi293 cells (Thermo Fisher) ...
-
bioRxiv - Immunology 2023Quote: ... heavy and light chain genes were synthesized by GenScript, inserted separately into plasmids (pCMV3-CH ...
-
bioRxiv - Molecular Biology 2021Quote: ... and CV3018 heavy and light chains were ordered from GenScript and cloned into pCMV/R ...
-
bioRxiv - Immunology 2023Quote: Antibody heavy and light chain genes were synthesized by GenScript, separately inserted into vector plasmids (pCMV3-CH ...
-
bioRxiv - Microbiology 2022Quote: ... Heavy chain variable (VH) and light chain variable (VL) genes for each antibody were synthesized (GenScript), then transfected into Expi293 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Immunology 2021Quote: ... DH1017.IgG and DH1017.Fab heavy and light chain plasmids (GenScript) were co-transfected at an equal ratio in suspension Expi 293i cells (Invitrogen ...
-
bioRxiv - Immunology 2020Quote: Genes encoding CR3022 heavy and light chains were ordered from GenScript and cloned into pCMV/R ...
-
bioRxiv - Immunology 2023Quote: Heavy and light chain sequences were synthesized and cloned by Genscript into IgG1 ...
-
bioRxiv - Immunology 2023Quote: ... The genes of selected heavy chains were synthesized as IgG1 (GenScript). Kappa and lambda chains were synthesized similarly ...
-
bioRxiv - Microbiology 2024Quote: A DNA fragment encoding ELC07 Fab heavy chain with a C-terminal hexahistidine (His6) tag and subcloned into pcDNA3.1 was generated by GenScript. The constructs used for expression of stabilised trimeric HIV-1 Env (BG505 SOSIP.664 ...
-
bioRxiv - Immunology 2023Quote: Antibody heavy chain and light chain genes were synthesized and cloned into plasmids containing the CMV promoter (GenScript). Final heavy and light chain plasmids were amplified ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Light chain of CTX/ATZ antibody and heavy chain fused with EndoTag at C-term constructs were ordered in CMVR from Genscript. Antibody-EndoTag fusions were then expressed via transient co-transfection of the EndoTag-heavy and light chains into Expi293F cells (Life Technologies ...
-
bioRxiv - Immunology 2021Quote: Selected pairs of heavy and light chain sequences were synthesized by GenScript and sequentially cloned into IgG1 and Igκ/λ expression vectors ...
-
bioRxiv - Immunology 2021Quote: ... Plasmids for the P1-05 heavy and light chain were synthesized (Genscript) and cloned into pcDNA3.1+ ...
-
bioRxiv - Immunology 2020Quote: ... Immunoglobulin heavy and light chain sequences were synthesized and cloned by Genscript into IgG1 ...
-
bioRxiv - Molecular Biology 2021Quote: ... CB6 (heavy chain GenBank MT470197, light chain GenBank MT470196) was custom produced in a mammalian cell system by Genscript.
-
bioRxiv - Bioengineering 2020Quote: Plasmids encoding cDNAs for the heavy chain of IgG were purchased from Genscript and cloned into the pFUSE-CHIg-hG1 vector (Invivogen) ...
-
bioRxiv - Microbiology 2021Quote: Genes encoding CV30 and CR3022 heavy and light chains were ordered from GenScript and cloned into pCMV/R ...
-
bioRxiv - Immunology 2022Quote: ... paired heavy (VDJ) and light (VJ) chain variable gene sequences were commercially synthesized (GenScript) and cloned into antibody expression plasmids (see Table S4E for GenBank accession numbers of heavy and light chain variable regions) ...
-
bioRxiv - Microbiology 2022Quote: ... The variable regions of heavy and light chains for each antibody were synthesized (GenScript), cloned into gWiz or pCDNA3.4 vector ...
-
bioRxiv - Immunology 2021Quote: ... plasmids encoding cDNAs for the heavy and light chain sequences of PhtD3-IgG2a were synthesized (GenScript), and cloned into pCDNA3.1+ ...
-
bioRxiv - Biophysics 2020Quote: ... Genes for the heavy and light chain of the CR3022 antibody were obtained from Genscript (USA) and cloned into the pcDNA3.4 vector
-
bioRxiv - Immunology 2022Quote: Antibody heavy and light chain genes were optimized for human cell expression and synthesized by GenScript. VH and VL were inserted separately into plasmids (pCMV3-CH ...
-
bioRxiv - Microbiology 2024Quote: ... The murine-human chimeric heavy and light chain sequences were then cloned into pGenDONR by GenScript, with a P2A sequence added between the heavy and light chain sequences to create the pGenDONR-IgG H1-P2A-Ig(λ ...
-
bioRxiv - Immunology 2021Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Microbiology 2021Quote: ... CR3022 antibody heavy and light chain genes were synthesised and subcloned into pcDNA3.4 vector by Genscript (USA).
-
bioRxiv - Immunology 2022Quote: ... Fab or IgG1 heavy and light chain genes were codon-optimized and synthesized by GenScript (Piscataway, NJ).
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Genetics 2020Quote: ... and CH3 genes of human immunoglobulin isotype IgG1 were added to the heavy chain variable region (Genscript, USA). Vectors that encoded the anti-FAM19A5-IgG1 antibody were transfected into HEK293F cells and the recombinant antibody was purified using Protein A beads (RepliGen) ...
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were similarly synthesized and cloned into the pcDNA3.1 vector (GenScript). Oligonucleotides were synthesized by IDT ...
-
bioRxiv - Immunology 2024Quote: ... The heavy immunoglobulin variable region sequences were inserted into the human heavy chain mu constant region secretory sequence (Genbank accession number BC073758.1) and synthesised into mammalian vector pcDNA3.1 (Genscript). Similarly ...
-
bioRxiv - Immunology 2020Quote: ... plasmids encoding cDNAs for the heavy and light chain sequences of 101F,64 MPE8,49 and DS747 were synthesized (GenScript), and cloned into vectors encoding human IgG1 and lambda or kappa light chain constant regions ...
-
bioRxiv - Immunology 2023Quote: The antibody heavy chain genes of matured AIIMS-P01 lineage antibody was synthesized after codon-optimization for mammalian expression from Genscript, Inc ...
-
bioRxiv - Microbiology 2022Quote: ... recombinant human ACE2-IgG-Fc fragments (r-hACE2-Fc) (GenScript, Z03516) were firstly incubated with the Protein-G agarose (Millipore ...
-
bioRxiv - Immunology 2023Quote: Antibody variable heavy and light chain regions were synthesized by gene synthesis with appended N-terminal signal sequences (Genscript Biotech, Piscataway, NJ) and subcloned into IgG1 or lambda or kappa light chain based PCDNA3.1 mammalian expression plasmids ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Immunology 2022Quote: ... Matched pairs of antibody VH and Vλ/Vκ sequences were commercially cloned into plasmids containing an IgG1 or relevant light chain backbone and expressed as recombinant antibody (Genscript). mAbs were also expressed in-house by transient transfection of Expi293 cells (Gibco ...
-
bioRxiv - Molecular Biology 2021Quote: ... the C-terminal fragment of the CLEC16A disease isoform (OHu02258D; Genscript) was liberated by BamHI restriction digest ...
-
bioRxiv - Microbiology 2021Quote: Plasmid constructs to produce recombinant proteins were made with a combination of synthesized DNA fragments (GenScript Biotech, Netherlands) and PCR amplicons using extracted culture gDNA as a template ...
-
bioRxiv - Neuroscience 2021Quote: TMEM106B C-terminal fragment (120 – 274) incorporated in pET3A was purchased from Genscript™ ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... we used custom polyclonal antibodies raised against recombinant fragment antigens generated by rabbits’ immunization (GenScript, Piscataway Township, NJ, USA). Each recombinant fragment was injected into three rabbits ...
-
Activation of endoplasmic reticulum stress via clustering of the inner nuclear membrane protein SUN2bioRxiv - Cell Biology 2022Quote: ... The construct consisting of nucleoplasmic and transmembrane domains of SUN2 and the luminal domain of SUN1 was created by amplifying SUN1 C-terminal fragment (AA 245-511) by PCR from pcDNA3.1+/C-(K)DY-SUN1 vector (OHu26731,GenScript # NM_001130965.3) using 5’-CTGTTCTAGAATGTTGGCTGGCCGTGG-3’forward and 5’-CTGTCTCGAGGCCCTGACTTGCACGTCCA-3’ reverse primers and subsequent cloning into MP029-CRY2-mCherry-SUN2-N-2 vector using the XbaI/XhoI restriction sites ...
-
bioRxiv - Cell Biology 2021Quote: ... The anti-Mps1 antibodies were generated in rabbits against a recombinant Mps1 protein fragment (residues 440-764) of the protein by Genscript. The company provided affinity purified antibodies that we validated by purifying kinetochores from yeast strains with Mps1 or Mps1-13Myc and confirming that the antibody recognized a protein of the correct molecular weight that migrated more slowly with the 13Myc epitope tags ...
-
bioRxiv - Microbiology 2022Quote: ... The N-terminal domain (Delta-like) of the SARS-CoV-2 Delta-Omicron recombinant spike was chemically synthesized as a short fragment (Genscript) and fused by overlapping PCR with the RBD and C-terminal parts of the BA.1 spike ...
-
bioRxiv - Biophysics 2023Quote: ... The anti-Scm3 antibodies were generated in rabbits against a recombinant Scm3 protein fragment (residues 1-28) of the protein by Genscript. The company provided affinity-purified antibodies that we validated by immunoprecipitating Scm3 from yeast strains with Scm3-V5 and confirming that the antibody recognized a protein of the correct molecular weight that was also recognized by α-V5 antibody (Invitrogen ...
-
bioRxiv - Immunology 2022Quote: ... The antibody expression constructs containing the heavy-chain and the light-chain variable region exons, with human constant region sequences (IgG1, Igκ) at the C terminus were made by Genscript. Monoclonal antibodies were generated using the Expi293 expression system (Thermo Fisher Scientific ...
-
bioRxiv - Immunology 2021Quote: A 96-well plate was coated overnight at 4ºC with 100 µL of a recombinant human ACE-2 fused to a Fc fragment (GenScript Laboratories, USA) at 1 µg/mL in carbonate buffer (pH 9.6) ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... custom polyclonal antibodies were generated in rabbits against recombinant fragments corresponding to regions that significantly differ between the two AGOs (GenScript, USA).