Labshake search
Citations for GenScript :
1 - 50 of 1120 citations for RFamide Related Peptide 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Pathology 2022Quote: ... Jagged-1 peptide (1 uM, Genscript), Y-27632 (10 uM ...
-
bioRxiv - Biochemistry 2023Quote: ... Depsi Aβ (1–42) peptide (click peptide) (Genscript, ref. RP10017) was dissolved in 0.1% TFA to a final concentration of 200 μM (stock solution ...
-
bioRxiv - Systems Biology 2024Quote: ... Calmodulin binding peptide 1 (MLCK peptide) was purchased from Genscript Biotech Corp ...
-
bioRxiv - Neuroscience 2019Quote: ... control non-related target knockdown (5′-AGTGGATTCGAG-AGCGTGT-3′) (GenScript). To produce lentiviral particles ...
-
bioRxiv - Bioengineering 2023Quote: ... 1 mM RGD peptide (GenScript) was added to the precursor solution ...
-
bioRxiv - Cell Biology 2022Quote: ... GRGDSPC peptide (1% w/v) (Genscript) was added to the solution ...
-
bioRxiv - Immunology 2019Quote: ... 1 μM of hgp100 peptide (GenScript) in complete DMEM was added for 1 hour at 37°C before co-culture with the pmel-1 T cells ...
-
bioRxiv - Immunology 2022Quote: ... and 1 μM TPI peptide (Genscript).
-
bioRxiv - Biophysics 2022Quote: ... and 1 μM TPI peptide (Genscript) for surface expression of TPI:HLA-DR1 ligand for the E8 TCR.35
-
bioRxiv - Immunology 2020Quote: ... DNA encoding the S protein ectodomains (residues 1-1194) from bat SARS-related CoV isolates Rs4231 and Rs4874 (ref.(Hu et al., 2017)) were synthesized (Genscript) with a C-terminal T4-Foldon domain or C-terminal GCN domain ...
-
bioRxiv - Synthetic Biology 2022Quote: ... gRNAs and related sequences were commercially synthesized (Integrated DNA Technologies IDT and GenScript) and then cloned into corresponding entry vectors using In-Fusion cloning (Takara Bio ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL 3X-FLAG peptide (Genscript). Final purification was achieved by size exclusion chromatography (SEC ...
-
bioRxiv - Cell Biology 2020Quote: ... and for generation of EGFP-C2-Arp3B plasmid, the mRNA transcript variant 1 encoding murine actin-related protein 3B (Actr3b) (Jay et al., 2000) was synthesized (GenScript Biotech) and cloned into pEGFP-C2 vector (Clontech).
-
bioRxiv - Immunology 2022Quote: Selected clonally related heavy sequences were ordered codon-optimized from GenScript (Hong Kong, China) and sub-cloned in the CMV/R expression vector [48,49] ...
-
bioRxiv - Immunology 2021Quote: ... and 1 mg/mL MOG35-55 peptide (Genscript). Mice were immunized on both flanks by subcutaneous injection of the emulsion for a total of 200 µL ...
-
bioRxiv - Plant Biology 2023Quote: ... 1 μM flg22 peptide (QRLSTGSRINSAKDDAAGLQIA, synthesized by Genscript), chitin (250 μg/ml) ...
-
bioRxiv - Bioengineering 2022Quote: ... a thiolated RGD peptide (GCGYGRGDSPG, 1 mM, GenScript), lithium acylphosphinate photoinitiator (LAP ...
-
bioRxiv - Biochemistry 2023Quote: LHa peptide (Table 1) was obtained from GenScript with a γ-aminobutanoate-mercaptopropionic acid linker (hereinafter referred to as LH2 peptide ...
-
bioRxiv - Immunology 2020Quote: Peptides and peptide libraries were generated by custom peptide synthesis (Genscript), re-suspended at 10 mg ml−1 in DMSO and placed at −80°C for prolonged storage ...
-
bioRxiv - Biochemistry 2022Quote: ... Various concentrations of H3K4me3 (1-21) substrate peptide (GenScript) were added with 1mM alpha-ketoglutarate to initiate demethylation by ∼1 μM KDM5C in 50 mM HEPES pH 7.5 ...
-
bioRxiv - Cell Biology 2023Quote: ... ZYG-1 peptides were produced by Genscript (Piscataway, NJ). For ZYG-1 peptide analysis ...
-
bioRxiv - Biochemistry 2021Quote: 1 µg/ml biotinylated stem peptide (15- or 16-residue long stem peptide-PEG6-Lys-Biotin synthesized fom Genscript) was loaded on SA biosensors to a threshold of 0.5 nm ...
-
bioRxiv - Biochemistry 2021Quote: ... at 25 °C. The peptides except for the H3.3 (a.a. 1–59) peptide were all purchased from GenScript (Nanjing). The H3.3 (a.a ...
-
bioRxiv - Immunology 2021Quote: ... 1 μg/ml biotinylated stem peptide (15- or 16-residue long stem peptide-PEG6-Lys-Biotin synthesized from Genscript) was loaded on SA biosensors to a threshold of 0.5 nm ...
-
bioRxiv - Neuroscience 2023Quote: Peptides (GenScript) were modified with a cysteine on the N-terminus ...
-
bioRxiv - Immunology 2019Quote: ... 1 × 106 cells were incubated with influenza Gp33 peptide (Genscript) at a final concentration of 05μg/mL in the presence of fluorescence-conjugated antibodies against CD107a and CD107b together with Brefeldin A for 5h before additional flow cytometric staining.
-
bioRxiv - Immunology 2022Quote: ... or TN peptide (β-hex peptide sequence YKGSRVWLN - GenScript)27 was added to the wells ...
-
bioRxiv - Neuroscience 2023Quote: ... while the Copiagag antibodies were generated against a Copia peptide antigen (see Figure 1) by immunizing rabbits with the peptide LMVVKNSENQLADIC (GenScript).
-
bioRxiv - Immunology 2021Quote: ... at a final concentration of 1 μg/mL per peptide (GenScript). Splenocytes were plated in duplicate at 1×105 cells per well and 2.5×104 cells per well (mixed with 7.5×104 naïve cells ...
-
bioRxiv - Molecular Biology 2021Quote: ... pS23-Ab 1:10,000 (Custom generated by GenScript; peptide sequence-CKILTHYENDSPTDLR). The cells were washed and incubated with secondary antibodies Alexa fluor 488 goat anti-mouse (Thermo fisher ...
-
bioRxiv - Microbiology 2023Quote: ... affinity-purified rabbit polyclonal (peptide SSTEPASTGTPSSGC, produced by GenScript, 1:1000), followed by donkey anti-rabbit Alexafluor555 (Invitrogen A31572 ...
-
bioRxiv - Immunology 2021Quote: ... peptide pools (GenScript) at a concentration of 2 μg/mL per peptide ...
-
Convergent evolution of distinct immune sensor systems for fungal polygalacturonases in BrassicaceaebioRxiv - Plant Biology 2020Quote: Synthetic peptides (GenScript) were prepared as 10 mM stock solutions in 100% dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Cell Biology 2019Quote: ... MTED peptide (Genscript) was shipped as lyophilised powder with a purity of 95.2% ...
-
bioRxiv - Immunology 2019Quote: Peptides (Table 1) and HLA-A*11:01-restricted KRAS G12V8-16 (VVGAVGVGK) as positive peptide were synthesized from GenScript (Nanjing, China), with purity greater than 98% by mass spectroscopy ...
-
bioRxiv - Microbiology 2022Quote: ... Fifteen-mer overlapping peptides from SARS-CoV-2 spike glycoprotein (Cat# PM-WCPV-S-1, JPT peptides, Berlin, Germany) and MeV-nucleoprotein (Genscript, NJ, USA) were used to stimulate splenocytes at 5 µg/mL ...
-
bioRxiv - Biochemistry 2019Quote: ... Peptide U12 (VSIGYLLVKHSQTDQ) and scrambled S16 peptide (SPIAVDVQSAPIHAI) were synthesized (Genscript). S16 conjugated at the N-terminus to HiLite-488 was also synthesized (Anaspec).
-
bioRxiv - Bioengineering 2022Quote: ... mixed with 2mM RGD peptide (peptide sequence: GRGDSPCG) purchased from GenScript, and we let them react at room temperature for 10 minutes ...
-
bioRxiv - Immunology 2022Quote: ... or 10x peptide to MHC ratio by molarity (peptides from GenScript). Final reaction volume was 20 μL and reaction mixtures were incubated at room temperature for 20-30 minutes.
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Cell Biology 2024Quote: FITC-labeled aminocaproic acid-disulfide-cyclized ACRGDGWCG peptide (FITC-cyclic-ACRGDGWCG) and FITC-labeled aminocaproic acid-GRGDLGRLKK peptide (FITC-proTGFβ3 peptide) were synthesized by GenScript. Preliminary experiments (Supplementary Fig ...
-
bioRxiv - Cell Biology 2020Quote: ... Antagonist peptide 1 (SCSLFTCQNGIV) and 2 (SCSLFTCQNGGGWF) were chemically synthesized by Genscript. Anti-Mouse-IgG (H&L ...
-
bioRxiv - Developmental Biology 2022Quote: ... Tartan (Rabbit, 1:100, This study, GenScript, based on Full-length peptide). Donkey and Goat secondary antibodies conjugated to AlexaFluor488 ...
-
bioRxiv - Plant Biology 2019Quote: Polyclonal antibodies against Peptide-1 was raised in rabbit (GenScript, NJ, USA). Crude proteins from root tissues ...
-
bioRxiv - Biochemistry 2022Quote: ... α-actinin-1 and myotilin derived peptides were obtained from Genscript (USA). For immunofluorescence imaging we used goat anti-human VPS35 (Abcam ...
-
bioRxiv - Microbiology 2022Quote: ... and 1 µM DrkBiT peptide (VSGWALFKKIS, synthesized by GenScript at >95% purity) was then prepared and added to wells in triplicate on four white 96-well plates (Greiner Bio-One) ...
-
bioRxiv - Neuroscience 2023Quote: The spike peptides (Table 1) were custom ordered and synthesized by Genscript, Netherlands as previously described in Nyström et al 2022 (20) ...
-
bioRxiv - Biochemistry 2023Quote: ... Fluorescence polarization tracer peptides and tau phospho-peptides were synthesized by Genscript.
-
bioRxiv - Immunology 2021Quote: ... Spike peptide library (GenScript) consisted of 316 peptides and was divided into 4 sub-pools spanning the S1 and S2 domains (1S1=1-86 ...
-
bioRxiv - Biochemistry 2020Quote: ... and substrate peptide (GenScript). Reactions were initiated with 5 mM ATP ...