Labshake search
Citations for GenScript :
1 - 50 of 203 citations for N Nitroso Di N Propylamine D14 98% since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: ... The linear peptides DMT1-II550-568 (AQPELYLLNTMDADSLVSR) and palmitoylated CI-MPR2347-2375 with N-terminal di-lysine (KKSNVSYKYSKVNKEEETDENETEWLMEEIQ) were both synthesised by Genscript (USA).
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant BRD4 N-terminal protein was purchased from GenScript (BRD4-N (49-460aa), His ...
-
bioRxiv - Biochemistry 2020Quote: ... or into pcDNA3.1-(+)-N-DYK (nsp2) to append an N-terminal FLAG tag (GenScript).
-
bioRxiv - Immunology 2020Quote: ... S1 and N proteins (Genscript) were conjugated onto MagPlex microsphere (Luminex ...
-
bioRxiv - Immunology 2023Quote: ... and N (GenScript, Cat No. A02090) were included at high (30µg/mL ...
-
bioRxiv - Microbiology 2022Quote: ... The SARS-CoV-2 N gene was PCR amplified from plasmids pUC57-SARS-CoV-2-N (GenScript) using forward primers with T7 promoter and reverse primers with poly(T)34 sequences ...
-
bioRxiv - Microbiology 2023Quote: ... The SARS-CoV-2 N gene was PCR amplified from plasmids pUC57-SARS-CoV-2-N (GenScript) using forward primers with T7 promoter and reverse primers with poly(T)34 sequences ...
-
bioRxiv - Synthetic Biology 2023Quote: ... SpyTag peptide (N-term-AHIVMVDAYKPTKGSGDRCG-C-term, N-term: Acetylation, C-term: Amidation, purity: 94%, GenScript Biotech) was dissolved in triethanolamine (TEA ...
-
bioRxiv - Cell Biology 2020Quote: pCDNA3.1-GFP-Rab10 and pCDNA3.1-Flag-Rab10 were generated by insertion of synthesized Rab10 cDNA into pCDNA3.1+N-EGFP plasmid or pCDNA3.1+/N-DYK plasmid from Genscript as described 13 ...
-
bioRxiv - Cell Biology 2021Quote: ... was purchased from GenScript (ref. n° OHu13506). The Myc-mKCNJ2-T2A-IRES-tdTomato.lti (#978 ...
-
bioRxiv - Cell Biology 2020Quote: ... into pcDNA3.1+N-MYC plasmid from Genscript.
-
bioRxiv - Cell Biology 2022Quote: Pulldown with N-terminally biotinylated peptides (GenScript) was carried out as follows ...
-
bioRxiv - Biochemistry 2023Quote: ... N and M were synthesized by GenScript to more than 98% purity except for the surrogate peptide for full-length GPC which could only be purified to 66% ...
-
bioRxiv - Biochemistry 2023Quote: The Fis1 N-terminal arm peptide (MEAVLNEL) with N-terminal acetylation and C-terminal amidation were purchased from GenScript who determined the peptide to be >95% pure by HPLC ...
-
bioRxiv - Immunology 2023Quote: ... The biotinylated SARS-CoV-2 fusion peptide (N’-biotin-DPSKPSKRSFIEDLLFNKVT-C’) and His-tagged HIV Env MPER peptide (N’-NWFDITNWLWYIKSGGSHHHHHHHH-C’) were chemically synthesized by GenScript.
-
bioRxiv - Molecular Biology 2019Quote: ... YBX1 was cloned into pcDNA3.1+N-EGFP (Genscript) and pmCherry-C1 (Clontech ...
-
bioRxiv - Microbiology 2021Quote: ... N-terminus biotinylated peptides were synthesized by Genscript. N-terminal GSGS linker sequence was added to all peptide sequences ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... expressing N-terminally FLAG-tag (GenScript, Leiden, Netherlands). A selection of truncated versions of the AhR and ARNT was done based on previously published data [27,30] ...
-
bioRxiv - Cancer Biology 2023Quote: ... PLXNB2 OHu01778C_pcDNA3.1(+) N-Terminal Flag-Tag (GenScript #SC1626), PLXNB2 OHu01778D_pcDNA3.1+/C- C-Terminal Flag-Tag (GeneScript #OHu01778D) ...
-
bioRxiv - Biochemistry 2023Quote: N-terminal biotinylated peptides were synthesized by Genscript at ≥95% purity and dissolved in 100% DMSO to a stock concentration of 10 µg/µL ...
-
bioRxiv - Biochemistry 2023Quote: ... or pcDNA-(+)-N-DYK vector for nsp2 (Genscript). An N-terminal truncation nsp3.1-FT (residues 1-749 ...
-
bioRxiv - Microbiology 2023Quote: ... SARS-CoV-2 spikes or their N-to-Q or N-to-A substituted variants were codon optimized and cloned into pcDNA3.1(+) plasmid (GenScript, Piscataway, NJ). The HIV gag/pol (pCMVΔR8.2 ...
-
bioRxiv - Biochemistry 2020Quote: ... or N-terminal poly-histidine-tag (Genscript, codon-optimized) was expressed in E ...
-
bioRxiv - Microbiology 2023Quote: ... anti-CsoS2-N (1:10,000 dilution; synthesized by GenScript, NJ ...
-
bioRxiv - Biophysics 2023Quote: ... and N (GenBank: NC_045512.2) genes were synthesized by Genscript, Inc ...
-
bioRxiv - Pathology 2021Quote: ... the recombinant N protein was constructed by inserting the N gene of SARS-CoV-2 into the pGEX-6P vector (GenScript Japan, Tokyo, Japan). Next ...
-
bioRxiv - Biochemistry 2020Quote: ... N-terminal CSF and “tethered” peptides were synthesized by GenScript. Chimeric G protein yeast strains were provided by GSK under material transfer agreement.
-
bioRxiv - Biochemistry 2020Quote: ... and a C-terminal TAMRA label (N-AAARKKRRQRRR-C, Genscript), and MerMade-synthesized unlabeled HIV-1 TAR ...
-
bioRxiv - Immunology 2023Quote: ... Plasmids encoding N-terminal domain proteins were obtained from GenScript. Plasmids were transiently co-transfected in FreeStyle 293-F cells using 293Fectin (ThermoFisher) ...
-
bioRxiv - Cancer Biology 2021Quote: ... that contains a N-terminal His TEV cleavage tag by Genscript. Protein expression was carried out in Escherichia coli C41(DE3) ...
-
bioRxiv - Biophysics 2020Quote: N-terminally formylated PSM peptides (> 95% purity) were purchased from GenScript Biotech ...
-
bioRxiv - Microbiology 2022Quote: ... M and N with respective promoters were synthesized commercially (GenScript, USA) and cloned in pBacPAK9 with restriction sites BamHI and EcoRI ...
-
bioRxiv - Immunology 2023Quote: ... SARS-CoV-2 N and S1 proteins were obtained from Genscript and Sino Biological.
-
bioRxiv - Molecular Biology 2023Quote: ... Peptides containing an N-terminal biotin tag were purchased from GenScript and dissolved according to manufacturer’s recommendation ...
-
bioRxiv - Biochemistry 2024Quote: N-terminally biotinylated synthetic FLAG peptide variants were ordered from Genscript. These were dissolved in SPR buffer (150 mM NaCl ...
-
bioRxiv - Molecular Biology 2020Quote: ... USP7 was expressed with an N-terminal myc-tag from pcDNA3.1 (Genscript). All mutations were generated by Genscript ...
-
bioRxiv - Developmental Biology 2019Quote: ... purified and N-terminally conjugated with KLH prior to injection (GenScript, USA). Polyclonal antibodies were affinity purified on the antigen and concentrated to 1.5 mg/mL ...
-
bioRxiv - Microbiology 2020Quote: ... Antibodies against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript) and GAPDH of anti-GAPDH (Proteintech ...
-
bioRxiv - Molecular Biology 2023Quote: ... were expressed in the pMA vector (pMA-SthCas6-4xcrRNA-N-gene, GenScript). Cas10 gene with 15HD>HA and 573GGDD>GGAA mutations was synthesized and cloned in pACYCDuet1-SthCas10-SthCsm2 plasmid using NcoI and NotI restriction sites ...
-
bioRxiv - Biochemistry 2023Quote: ... which contains an N-terminal pelB signal sequence and hexahistidine tag (Genscript). The construct was transformed into chemically competent C41 (DE3 ...
-
LRP1 mediates leptin transport by coupling with the short-form leptin receptor in the choroid plexusbioRxiv - Neuroscience 2023Quote: ... and pcDNA3.1(+)-N-HA-mLepR (mouse LepR isoform A CDS; NM_001122899.2, Genscript) using Lipofectamine 3000 (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2024Quote: ... N-terminal acetylated ChREBP peptide used for crystallization was purchased from GenScript Biotech Corp ...
-
bioRxiv - Microbiology 2020Quote: ... Antibody against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript, USA) and GAPDH of anti-GAPDH (Proteintech ...
-
bioRxiv - Immunology 2021Quote: ... and S1 subunit (0.5 µg/mL) (cat n° Z03501, GenScript, Piscataway, NJ, USA) purified recombinant proteins dissolved in carbonate-bicarbonate buffer (pH 9.6 ...
-
O-GlcNAcylation reduces phase separation and aggregation of the EWS N-terminal low complexity regionbioRxiv - Biochemistry 2021Quote: ... residues 1-264 (N-terminal LCR; LCRN) was synthesized by GenScript (Piscataway, NJ, USA) with codon optimization for expression in Escherichia coli ...
-
bioRxiv - Systems Biology 2021Quote: ... cell were stained overnight at 4°C with SARS-CoV-2 N-antibody (Genscript) at a dilution of 1:500 in PBS + 1% BSA+ 1%FBS ...
-
bioRxiv - Microbiology 2021Quote: ... Viral RNA copy number/mL supernatant was assessed using pCDNA3.1(+)-N-eGFP plasmid (GenScript) as standard.
-
bioRxiv - Biochemistry 2021Quote: The gene for N102LT N-terminally fused with tagRFP (gi: 336287738) was synthesised (GenScript) and inserted to unmodified pQlinkN plasmid using restriction enzyme cloning ...
-
bioRxiv - Biochemistry 2022Quote: ... The sequence encoding mouse alpha-DG N terminal domain(a-DGN) was synthesized (Genscript) and cloned into the AAV backbone under the transcriptional control of the ubiquitous CMV promoter ...
-
bioRxiv - Microbiology 2023Quote: Synthetic peptides of P covering the sequence N-EDDIYQLIM-C were obtained from GenScript. The peptide was dissolved in deionised water dosed with a drop of 5 M NH4OH to improve solubility ...