Labshake search
Citations for GenScript :
1 - 50 of 715 citations for Mouse Ras Related Protein M Ras MRAS ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2022Quote: ... FN3SH2 and h-Ras genes were synthesized by GenScript (Piscataway, NJ). cpFN3SUMO and cpFN3WDR5 genes were synthesized by Eurofins Genomics (Louisville ...
-
bioRxiv - Genetics 2022Quote: ... HA-tagged Ric- and Ras-expressing constructs were ordered as custom genes from GenScript and transferred into the pattB vector (Bischof et al ...
-
bioRxiv - Neuroscience 2019Quote: ... control non-related target knockdown (5′-AGTGGATTCGAG-AGCGTGT-3′) (GenScript). To produce lentiviral particles ...
-
bioRxiv - Cell Biology 2020Quote: ... and for generation of EGFP-C2-Arp3B plasmid, the mRNA transcript variant 1 encoding murine actin-related protein 3B (Actr3b) (Jay et al., 2000) was synthesized (GenScript Biotech) and cloned into pEGFP-C2 vector (Clontech).
-
bioRxiv - Immunology 2023Quote: ... the commercialized ELISA kit (Genscript, Cat#L00871) was used ...
-
bioRxiv - Molecular Biology 2024Quote: ... Other pAAV-related plasmids were developed by modifying these plasmids using standard molecular biology techniques and the GenBuilder Cloning kit (GenScript). PCR primers and oligonucleotides used were obtained from Integrated DNA Technologies (IDT) ...
-
bioRxiv - Cell Biology 2019Quote: IL-6 concentrations in the cell supernatant were were detected utilizing mouse IL -6 ELISA kit t (A015171517) purchased from GenScript Biological Technology Co.Ltd ...
-
bioRxiv - Synthetic Biology 2022Quote: ... gRNAs and related sequences were commercially synthesized (Integrated DNA Technologies IDT and GenScript) and then cloned into corresponding entry vectors using In-Fusion cloning (Takara Bio ...
-
bioRxiv - Immunology 2022Quote: Selected clonally related heavy sequences were ordered codon-optimized from GenScript (Hong Kong, China) and sub-cloned in the CMV/R expression vector [48,49] ...
-
bioRxiv - Immunology 2020Quote: ... ELISA plates were coated with 200 ng/well CoV2 RBD protein (GenScript; Cat: Z03483) overnight at 4°C ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Protein C (mouse, Genscript, A01774, 1:1000), anti-α-tubulin (mouse ...
-
bioRxiv - Immunology 2019Quote: 96-well ELISA plates were coated overnight at 4°C with mouse anti-Avi-tag antibody (Genscript) at 2 μg/ml in PBS ...
-
bioRxiv - Immunology 2021Quote: Competitive inhibition ELISA was performed using SARS-CoV-2 neutralization antibody detection kit (Genscript). The kit detects circulating neutralizing antibodies against SARS-CoV-2 that block the interaction between the receptor binding domains of the viral spike glycoprotein (RBD ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Immunology 2020Quote: ... were coated in 1 carbonate buffer (0.1 M at pH 9.6) with 1.0 ug/ml S1 protein (GenScript). The plates were incubated overnight at 4°C in a humidified chamber and then blocked in PBS plus 0.05% Tween 20 (PBST ...
-
bioRxiv - Synthetic Biology 2020Quote: ... The His-tagged GMCSF peptide was quantified using a His Tag ELISA Detection Kit (GenScript) according to the provided protocol and 5-10 fold dilutions of frozen samples.
-
bioRxiv - Microbiology 2024Quote: ... M-CSF (Genscript) for six days ...
-
bioRxiv - Immunology 2020Quote: ... DNA encoding the S protein ectodomains (residues 1-1194) from bat SARS-related CoV isolates Rs4231 and Rs4874 (ref.(Hu et al., 2017)) were synthesized (Genscript) with a C-terminal T4-Foldon domain or C-terminal GCN domain ...
-
bioRxiv - Biochemistry 2020Quote: ... immunized animal sera were tested by indirect ELISA and competitive ELISA for immune response by GenScript. Western Blot evaluation of pre-sera and sera after 3rd immunization against 200 ng of purified protein/lane using a 1:1000 dilution was performed in-house as described ...
-
bioRxiv - Immunology 2021Quote: RBD and NP end-point titers were determined using standard ELISA and plates coated with 500 ng/mL SARS-CoV-2 Spike-protein Receptor-Binding Domain (RBD) (GenScript, Piscataway NJ) or 1ug/mL SARS-CoV-2 nucleocapsid protein (NP) ...
-
bioRxiv - Immunology 2021Quote: RBD end-point titers were determined using standard ELISA and plates were coated with 500 ng/mL SARS-CoV-2 Spike-protein Receptor-Binding Domain (RBD) (GenScript, Piscataway NJ) Heat inactivated plasma (1:50 in blocking buffer ...
-
bioRxiv - Biochemistry 2022Quote: ... as a C-terminal fusion to an N-terminal small ubiquitin-related modifier (SUMO) tag using BsaI and XhoI (GenScript, Piscataway, NJ, USA). This results in a construct that ...
-
bioRxiv - Cell Biology 2024Quote: Protein lysates were incubated with 1 µg mouse anti-V5 antibody (Genscript A01724) for 2 h at 4°C ...
-
bioRxiv - Bioengineering 2023Quote: ... mAb was preferred for ELISA (GenScript, Cat.#A01854). For western blotting ...
-
bioRxiv - Microbiology 2020Quote: Mouse mAb 10G6H5 against SARS-COV2 S protein was purchased from GenScript (Piscataway, NJ). Rabbit antisera against the S1 subunit ...
-
bioRxiv - Systems Biology 2020Quote: ... and 10ng/ml M-CSF (GenScript) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... GILTco1-m-ApoE1-L and GILTco1-m-ApoE2-L were designed using GenSmart™ Codon Optimization Tool (GenScript). Human GAA coding sequence variant GILTco2-m was designed using GeneArt codon optimization algorithm (Thermofisher Scientific) ...
-
bioRxiv - Biochemistry 2023Quote: ... N and M were synthesized by GenScript to more than 98% purity except for the surrogate peptide for full-length GPC which could only be purified to 66% ...
-
bioRxiv - Synthetic Biology 2023Quote: The expression levels of his-tagged nanobodies resulting from microfermentations were quantified using the His tag ELISA detection kit (GenScript, Cat# L00436) according to the manufacturer’s protocol ...
-
bioRxiv - Plant Biology 2022Quote: ... His-FmASP protein was detected by immunoblotting with using a mouse anti-His antibody (GenScript, A00186). The immunoblotting band signals were visualized by enhanced enhanced chemiluminescence (ECL ...
-
bioRxiv - Immunology 2021Quote: ... preliminary ELISA screening and production of hybridomas were performed by Genscript as follows ...
-
bioRxiv - Cell Biology 2024Quote: ... and tested for affinity with ELISA and Western blot by Genscript.
-
bioRxiv - Microbiology 2020Quote: Endotoxin of all purified proteins was removed with ToxinEraserTM Endotoxin Removal Kit (Genscript) in accordance to the manufacturer’s instruction ...
-
bioRxiv - Microbiology 2021Quote: ... All the proteins were endotoxin free (ToxinEraserTM Endotoxin Removal Kit, GenScript Biotechnology, Nanjing, China).
-
bioRxiv - Cell Biology 2020Quote: ... the DNA encoding m-Scarlet was synthesized (GenScript, Piscataway, NJ), PCR amplified and cloned into pCM189 plasmid(56 ...
-
bioRxiv - Microbiology 2020Quote: ... the fixed cells were labeled with primary antibodies including goat anti-major outer-membrane protein (MOMP; Meridian, Memphis, TN) and mouse or rabbit anti-six histidine tag (Genscript, Nanjing ...
-
bioRxiv - Microbiology 2020Quote: ... A MERS-CoV M-specific rabbit antiserum was ordered from Genscript and produced using as antigen a synthetic peptide representing the C-terminal 24 residues of the protein (CRYKAGNYRSPPITADIELALLRA) ...
-
bioRxiv - Microbiology 2022Quote: ... M and N with respective promoters were synthesized commercially (GenScript, USA) and cloned in pBacPAK9 with restriction sites BamHI and EcoRI ...
-
bioRxiv - Molecular Biology 2023Quote: A bacterial codon-optimized human MITF-M+ ORF synthesized by GenScript Biotech was cloned using Gibson assembly (New England Biolabs ...
-
bioRxiv - Immunology 2024Quote: ... Heat 500 μl of mouse serumat 56℃ and then incubated the heated serum with 1 ml of washed Protein-G resin (GenScript L00209) overnight at 4°C ...
-
bioRxiv - Cell Biology 2019Quote: ... Phospho-peptides conjugated to biotin for ELISA assay were synthesized by GenScript (Hong Kong). Antibodies against the IR β-subunit (sc-57342 ...
-
bioRxiv - Neuroscience 2020Quote: ... Purified monomer protein passed through two to three rounds of endotoxin removal (Endotoxin removal kit, GenScript) to reach a level of <0.1 EU mg-1 ...
-
bioRxiv - Neuroscience 2022Quote: ... The purified proteins were made endotoxin free using the Toxineraser endotoxin removal kit (Genscript, Piscataway, NJ). For fibrillation ...
-
bioRxiv - Neuroscience 2023Quote: ... Purified monomer protein was subjected to two to three rounds of endotoxin removal (Endotoxin removal kit, GenScript) until a level of <0.1 EU per mg was achieved ...
-
bioRxiv - Microbiology 2021Quote: ... Mouse (GenScript) followed by 1:4000 Goat Anti-Mouse IgG Antibody (H&L ...
-
bioRxiv - Plant Biology 2023Quote: ... RNA samples were treated with M-MuLV Reverse Transcriptase following manufacturer’s instructions (GenScript, USA). The synthesized cDNA was used in qRT-PCR assays to determine transcript levels of the target genes.
-
bioRxiv - Microbiology 2023Quote: ... Mouse (GenScript™) followed by 1:4000 Goat Anti-Mouse IgG Antibody (H&L ...
-
Analysis of spike protein variants evolved in a novel mouse model of persistent SARS-CoV-2 infectionbioRxiv - Microbiology 2023Quote: Recombinant SARS-CoV-2 wild-type S protein RBD-HRP fusion protein (RBD-HRP protein, cat. no. Z03594) and hACE2 protein (cat. no. Z03516) were purchased from GenScript Korea Ltd ...
-
bioRxiv - Microbiology 2021Quote: ... and protein purification was performed with Protein A magnetic beads (GenScript, L00695). The purified mAbs were dialyzed against phosphate-buffered saline (PBS ...
-
bioRxiv - Microbiology 2020Quote: ... Antibodies against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript) and GAPDH of anti-GAPDH (Proteintech ...