Labshake search
Citations for GenScript :
1 - 50 of 263 citations for JNK Rabbit Polyclonal since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... A rabbit polyclonal antibody (Genscript) produced against full-length Drosophila p23 (Q9VH95 ...
-
bioRxiv - Cell Biology 2021Quote: ... Rabbit anti–c-Myc polyclonal (GenScript) and HRP-conjugated goat anti-rabbit antibody (Jackson ImmunoResearch Laboratories ...
-
bioRxiv - Microbiology 2020Quote: ... rabbit polyclonal anti-HPIV3 NP (GenScript, custom made against peptide ...
-
bioRxiv - Microbiology 2021Quote: ... or CaTpk2 rabbit polyclonal antibody (GenScript), at 1:1,000 dilution in 5% nonfat dry milk in TBS-T buffer plus 0.5% sodium azide for 2 hours at room temperature ...
-
bioRxiv - Developmental Biology 2020Quote: ... and rabbit polyclonal anti-pSer10 (GenScript, A00339). Secondary antibodies (with minimal species cross reactivity ...
-
bioRxiv - Microbiology 2020Quote: Custom rabbit polyclonal antibodies (GenScript, Nanjing, China) raised against tryptic peptides of Mtb EsxN (AQAASLEAEHQAIVR ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit polyclonal anti OLLAS (Genscript, 1:1500), rabbit polyclonal anti PAR (Trevigen ...
-
bioRxiv - Microbiology 2023Quote: ... rabbit polyclonal anti-BiP (1:600, GenScript) serum ...
-
bioRxiv - Molecular Biology 2022Quote: Rabbit polyclonal antibodies were generated by Genscript using the following peptides where additional single Cysteine residues for the cross-linking purpose are indicated in lowercase ...
-
bioRxiv - Cell Biology 2024Quote: ... occludin and GFP (#A01388, rabbit polyclonal, GenScript). GAPDH (#AB0060 ...
-
bioRxiv - Developmental Biology 2022Quote: To generate a custom rabbit polyclonal antiserum (GenScript), a poly-histidine tagged DUXBL fragment (aminoacids 193-350 ...
-
bioRxiv - Cancer Biology 2024Quote: ... rabbit polyclonal β-catenin(A01211-40; Genscript, China), rabbit polyclonal YAP1(A1002 ...
-
bioRxiv - Plant Biology 2023Quote: Rabbit polyclonal antibodies were obtained from GenScript (NJ, USA). Epitopes were chosen based on the manufacturer’s prediction algorithm results in regions that were covered by the protein sequencing ...
-
bioRxiv - Microbiology 2022Quote: ... in-house custom rabbit anti-RVFV nucleoprotein polyclonal antibody (Genscript) and anti-pan cytokeratin typeI/II anti-cytokeratin polyclonal antibody (Invitrogen ...
-
bioRxiv - Microbiology 2019Quote: ... A custom rabbit polyclonal antibody raised against XP peptide SNSGNRVSQDQNLQ (GenScript; only able to detect strongly overexpressed XP ...
-
bioRxiv - Cell Biology 2022Quote: Polyclonal Sgs1 was raised in rabbits using the peptide RTTRRRPTTPKTPD (Genscript) and was affinity purified (GenScript) ...
-
bioRxiv - Genomics 2021Quote: ... The following antibodies were used: Gcn5 (rabbit polyclonal, 1:1000, (GenScript antibody services ...
-
bioRxiv - Genomics 2021Quote: ... Ada2b (rabbit polyclonal, 1:1000; GenScript anti-amino-acid 1-330); anti-Flag-horseradish peroxidase (mouse ...
-
bioRxiv - Plant Biology 2022Quote: ... and used it to raise a polyclonal antibody in rabbit (Genscript). Anti-AtSMC3 and anti-GFP (Roche 11814460001 ...
-
bioRxiv - Microbiology 2023Quote: ... Polyclonal anti-tapasin and anti-US10 were raised in rabbits (GenScript) using synthetic peptides (aa 418-428 and aa 54-67 ...
-
bioRxiv - Microbiology 2023Quote: ... affinity-purified rabbit polyclonal (peptide SSTEPASTGTPSSGC, produced by GenScript, 1:1000), followed by donkey anti-rabbit Alexafluor555 (Invitrogen A31572 ...
-
bioRxiv - Genetics 2019Quote: Rabbit polyclonal antibody for full-length mouse ZCWPW1 was made by GenScript. Rabbits were immunized with the full-length ZCWPW1 recombinant protein ...
-
Molecular structure and conformation of stereocilia tip-links elucidated by cryo-electron tomographybioRxiv - Neuroscience 2021Quote: Rabbit polyclonal and monoclonal antibodies were generated using standard techniques by Genscript using the soluble PCDH15 EC1-EL extracellular region as the antigen ...
-
bioRxiv - Microbiology 2022Quote: ... The polyclonal antibody against CrPV-1A in rabbits was generated by Genscript. USA.
-
bioRxiv - Microbiology 2019Quote: ... discoideum crude extract with an anti-FLAG rabbit polyclonal antibody (GenScript, USA). For ectopic expression assays ...
-
bioRxiv - Plant Biology 2019Quote: Polyclonal antibodies against Peptide-1 was raised in rabbit (GenScript, NJ, USA). Crude proteins from root tissues ...
-
bioRxiv - Genetics 2021Quote: ... Erg11 anti-peptide rabbit polyclonal antibody was produced by GenScript (Piscataway, NJ). The peptide sequence was AKIYWEKRHPEQKY ...
-
bioRxiv - Molecular Biology 2021Quote: ... The purified protein was used for raising polyclonal antibodies in rabbits (Genscript). Optimal detection of SAP05 in phytoplasma-infected plants occurred at a 1:2,000 dilution of the antibody ...
-
bioRxiv - Cell Biology 2020Quote: A custom rabbit anti-TbKH polyclonal antibody (pAb) was generated by GenScript, using their 49-day antibody generation protocol ...
-
bioRxiv - Molecular Biology 2024Quote: Polyclonal rabbit antibodies against phopsho-TRF1 and TRF2 were generated by Genscript. Briefly ...
-
bioRxiv - Molecular Biology 2024Quote: ... Affinity-purified rabbit polyclonal antibodies specific to each eIF4E family member (Genscript) were used as the primary probe in western blotting ...
-
bioRxiv - Microbiology 2024Quote: ... anti-PicA (dilution = 1:1,000; custom polyclonal rabbit antibody generated by GenScript), and anti-RpoB-HRP (loading control ...
-
bioRxiv - Molecular Biology 2021Quote: ... and a rabbit polyclonal antibody specific for calmodulin-binding peptide (A00635-40, GenScript), a Goat anti-Rabbit IgG (H+L ...
-
bioRxiv - Microbiology 2021Quote: ... using primary antibodies specific for MeV F HRC (rabbit polyclonal, Genscript, 503028-1) and 6xHis tag (rabbit polyclonal ...
-
bioRxiv - Microbiology 2021Quote: ... using primary antibodies specific for MeV F HRC (rabbit polyclonal, Genscript, 503028-1) and 6xHis tag (rabbit polyclonal ...
-
bioRxiv - Genomics 2021Quote: ... H2A.X and H2A.Z antibodies are affinity-purified rabbit polyclonal antibodies made by GenScript USA Inc (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: ... The immunization of rabbits and affinity purification of p239-specific polyclonal antibody from immunized rabbits were conducted by Genscript Co ...
-
bioRxiv - Cell Biology 2019Quote: ... Rabbit polyclonal antibodies against PfAlba3 resulting from immunizations of rabbits with the KLH-conjugate peptide IGKRMFTGNEEKNP were obtained from GenScript Corporation [65] ...
-
bioRxiv - Microbiology 2021Quote: ... 0.2% Tween-20) for 30 min and probed with CaBcy1 rabbit polyclonal antibody (GenScript) or CaTpk2 rabbit polyclonal antibody (GenScript) ...
-
bioRxiv - Cell Biology 2022Quote: ... GiGrx5 and GiBolA proteins were detected by a rabbit anti-BAP polyclonal antibody (GenScript). Mitosomal GiTom40 and GiIscU were detected with a specific polyclonal antibody raised in rabbits (84) ...
-
bioRxiv - Microbiology 2023Quote: ... Membranes were probed with an anti-EsxA1 rabbit polyclonal antibody (0.5 μg/ml; GenScript) in the above LI-COR blocking buffer overnight at 4°C ...
-
bioRxiv - Microbiology 2021Quote: Polyclonal Rabbit antibodies against the potential S-Layer protein of A_DKE were generated by GenScript Biotech B ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Physiology 2021Quote: ... affinity purified anti-ayRhp1 rabbit polyclonal antibodies were developed (GenScript USA, Inc., Piscataway, NJ, USA) against the peptide HNKDAHGSHKEGSN ...
-
bioRxiv - Plant Biology 2021Quote: ... the SGQKPLTLAEFTIGGSQ peptide was synthesized and polyclonal antiserum was raised in rabbit (GenScript, Tokyo, Japan). Anti-rabbit IgG horseradish peroxidase-linked antibody (Promega ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit polyclonal short XIRP2 antibody (custom generated against the immunizing peptide NSKRQDNDLRKWGD, Genscript, 1:100), mouse monoclonal IgG1 γ-actin antibody (1-24 ...
-
bioRxiv - Plant Biology 2023Quote: ... then incubated with 1:1000 dilution of custom rabbit anti-IPD3 polyclonal antibody (Genscript, China) followed by 1:2,500 donkey anti-rabbit AlexaFluor 488- conjugated secondary antibodies (Thermo Fisher ...
-
bioRxiv - Physiology 2019Quote: ... The primary antibody was prepared using a custom affinity-purified rabbit polyclonal antibody (Genscript, Piscataway, NJ) produced against Rhodnius prolixus RhoprCAPA-2 (EGGFISFPRV-NH2 ...
-
bioRxiv - Plant Biology 2021Quote: ... This polyclonal antibody was raised in rabbits against a synthetic peptide (CKTYLGRPWKEYSRT) (Genscript, Piscataway, NJ, USA) that includes the highly conserved amino acid sequence including residue in the catalytic site of PMEs (Markovič and Janeček ...
-
bioRxiv - Biophysics 2019Quote: ... His-tagged Xenopus laevis HAUS8 was used to produce rabbit polyclonal anti-HAUS8 anti-serum (Genscript). Alexa-647 labelled XenC antibody was generated by first dialyzing antibodies in PBS buffer (50mM NaPO4 ...