Labshake search
Citations for GenScript :
1 - 50 of 547 citations for Astrovirus Antigen Type 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... 96-well plates were coated with 2 μg/mL of recombinant Karp type-specific antigen 56 (TSA56, generated by Genscript) in PBS and blocked with 1% BSA ...
-
bioRxiv - Plant Biology 2019Quote: ... 1:500 (produced for this study using full length protein as antigen by GenScript); α-Actin ...
-
bioRxiv - Microbiology 2020Quote: Commercially produced purified antigens were supplied by GenScript as follows ...
-
bioRxiv - Molecular Biology 2020Quote: ... The antigen coding sequence was synthesized by GenScript to reflect the preferred human codon usage and synthetic restriction sites were added to the 5’ (HindIII and AgeI ...
-
bioRxiv - Cancer Biology 2021Quote: ... the melanoma cells were spiked with gp100+ antigens (GenScript) just before addition of T-cells ...
-
bioRxiv - Microbiology 2022Quote: ... and polyclonal αcGAS antibodies were purified by antigen affinity (GenScript). Serum was used at 1:30,000 for cGAS detection ...
-
bioRxiv - Cell Biology 2021Quote: FUS-CHOP type I and type II genes were synthesized by Genscript (Piscataway, NJ) and subcloned into pcDNA3-EGFP (Addgene 13031 ...
-
bioRxiv - Immunology 2020Quote: ... The Pmel-1 melanoma antigen-derived peptide mgp10025-33 (EGSRNQDWL) (32) was custom synthesized by GenScript (Scotch Plains, NJ, USA) to more than 80% purity ...
-
bioRxiv - Neuroscience 2023Quote: ... while the Copiagag antibodies were generated against a Copia peptide antigen (see Figure 1) by immunizing rabbits with the peptide LMVVKNSENQLADIC (GenScript).
-
bioRxiv - Immunology 2022Quote: ... 5 μl synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), or 5 μl heat-killed bacteria in PBS ...
-
bioRxiv - Immunology 2020Quote: ... The multiplex antigen panel was completed with commercial S1 (GenScript Biotech, Netherlands) and S2 (Sino Biologicals ...
-
bioRxiv - Cell Biology 2023Quote: ... accession number XM_006514830.3) and type 3 (transcript variant 1, accession number NM_001363282.1) was purchased from GenScript (Clone IDs OMu45282 and OMu45285 ...
-
bioRxiv - Cell Biology 2024Quote: Wild-type and analog-sensitive Chk2 ORF sequences were cloned in the pGex6p-1 plasmid (Genscript, see plasmid construction section for details ...
-
bioRxiv - Immunology 2022Quote: ... 5 μl of a synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), eBioscience Cell Stimulation Cocktail (Fisher Scientific 00-4975-93 ...
-
bioRxiv - Developmental Biology 2020Quote: ... Antigen for the custom anti-Nrl antibody (commissioned from Genscript, Piscataway, NJ, USA) was recombinant protein matching the C-terminal 112 amino acids of zebrafish Nrl (residues 301-412 of GenBank ...
-
bioRxiv - Microbiology 2020Quote: ... EsxA and SodA were generated for this study (Customer’s Antigen Polyclonal Antibody Package, Genscript). C-terminally his6-tagged SiEsaA41-871 ...
-
bioRxiv - Neuroscience 2023Quote: The wild-type construct was synthesized by Genscript Biotech by adding eGPF (accession JN204884.1) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2023Quote: ... or 9 ug/mL of full-length FimH protein (antigen for custom antibody production, Genscript) was used.
-
bioRxiv - Genomics 2023Quote: ... plasmids containing wild type ORFs were obtained from GenScript. The ORFs were cloned into the pcDNA3.1(- ...
-
bioRxiv - Biophysics 2024Quote: ... TTR type was determined by transferring the gel contents to a 0.2 µm nitrocellulose membrane and probing with a primary antibody (1:1000) directed against the C-terminal region of the wild type TTR sequence (GenScript). Horseradish peroxidase-conjugated goat anti-rabbit IgG (Invitrogen ...
-
bioRxiv - Synthetic Biology 2022Quote: ... The wild type AAV9 capsid gene sequence was synthesized (GenScript) with nucleotide changes at S448 (TCA to TCT ...
-
bioRxiv - Biophysics 2023Quote: ... and αS ΔNAC: Wild-type plasmids were synthesized from Genscript ® and the rest of the constructs were cloned at Florida State University ...
-
bioRxiv - Cell Biology 2022Quote: ... ferritin L (Ft-L) made by using purified human ferritin L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Evolutionary Biology 2020Quote: ... we used custom polyclonal antibodies raised against recombinant fragment antigens generated by rabbits’ immunization (GenScript, Piscataway Township, NJ, USA). Each recombinant fragment was injected into three rabbits ...
-
bioRxiv - Microbiology 2019Quote: ... PRV Us9 wild-type and mutant genes were synthesized (Genscript, Piscataway, NJ). The cellular gene Kif1A was PCR amplified from rat cDNA ...
-
bioRxiv - Developmental Biology 2021Quote: ... wild-type and mutated deiChO-262 fragments were synthesized by GenScript (USA) and cloned into the reporter constructs placZattB (Table S4) ...
-
bioRxiv - Biochemistry 2024Quote: ... wild-type human caspase-3 was synthesized by GenScript (Piscataway, NJ, USA), codon-optimized for expression in E ...
-
bioRxiv - Plant Biology 2020Quote: ... The protein was purified using GST-tag affinity and used directly as an antigen in rabbits (Genscript, Piscataway, NJ, USA). The resulting antiserum was used at a dilution of 1:30.000 ...
-
bioRxiv - Plant Biology 2022Quote: ... the gels were firstly analyzed through immunoblotting with anti-PDR6 antibody (prepared with peptide CTVVEEGKDKHKGSH as antigen by GenScript, China) and a horseradish peroxidase-conjugated antirabbit IgG secondary antibody (Beyotime Biotechnology ...
-
bioRxiv - Cell Biology 2022Quote: ... The primary antibody against Ft-L was made using recombinant human Ft-L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Neuroscience 2023Quote: Custom rabbit polyclonal antibodies recognising CG2233 were generated using PolyExpressTM Premium antigen-specific affinity purified pAb package provided by GenScript. Antibodies were generated against recombinant CG2233 that lacks its N-terminal signal sequence (MFSINAVILGILVTSVMA ...
-
bioRxiv - Microbiology 2021Quote: The synthetic gene encoding the BT_1526 ORF (wild type) was ordered from Genscript cloned into a pET-28a expression plasmid with a six-histidine tag at the N-terminus ...
-
bioRxiv - Microbiology 2023Quote: Sequential site-directed mutagenesis was performed using wild-type ALKBH1 plasmid (OHu05179, GenScript) as a template with the following primer pairs ...
-
bioRxiv - Immunology 2021Quote: ... Antigens included recombinant SARS-CoV−2 RBD protein obtained from the Saphire laboratory at LJI or recombinant nucleocapsid protein (GenScript Z03488). The next day ...
-
bioRxiv - Immunology 2021Quote: ... A blank consisting of the blocking buffer and a standard curve ranging from 5000 pg/mL to 78.25 pg/mL of S1 antigen (GenScript, Cat# Z03501) in blocking buffer were also added in duplicates on the plate followed by incubation at room temperature for 1 hour ...
-
bioRxiv - Biophysics 2020Quote: ... To determine the binding affinities between antigens and antibody mouse monoclonal anti-His-tag IgG (clone 6G2A9, The™ His tag Ab, GenScript) was captured on the surface of active flow cell to the level of 100-200 RU ...
-
bioRxiv - Biochemistry 2022Quote: The wild-type bovine MRP4 gene and the MRP4E1202Q mutant were synthesized by Genscript and cloned into pFastBac with a C-terminal thrombin-cleavable 8xHis tag ...
-
bioRxiv - Biophysics 2022Quote: The receptor constructs including wild-type CCR5 and all phosphosite mutants were synthesized from GenScript and subcloned in pcDNA3.1(+ ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: Human C-type natriuretic peptide (CNP) and rat atrial natriuretic peptide (ANP) were from GenScript Corp ...
-
bioRxiv - Biophysics 2023Quote: ... The gene encoding the wild-type hSOD1 of the native sequence was purchased from Genscript with E ...
-
bioRxiv - Biochemistry 2021Quote: Wild-type USP14 and mutants were cloned into pGEX-4T vector obtained from GenScript (Nanjing, China). For purification of recombinant USP14 and mutants ...
-
bioRxiv - Biochemistry 2021Quote: ... The wild-type protein and the mutant K96A cloned in pET28a vector were ordered from GenScript. The N-terminally truncated constructs were cloned by amplifying the sequence from the original vector and subcloning into BsaI-cleaved plasmid pNIC28_Bsa4 by SLiCE cloning (83) ...
-
bioRxiv - Biochemistry 2023Quote: ... wild-type OGG1 was expressed with a GST tag from a pGEX-6P1clone purchased from GenScript. The plasmid was transformed into T7 Express plysS Competent E ...
-
bioRxiv - Molecular Biology 2023Quote: The wild-type ASPA cDNA and selected variants studied in low throughput were generated by Genscript. The library cloning and barcoding described below are essentially as previously described 69 ...
-
bioRxiv - Biochemistry 2022Quote: Codon optimized human wild-type full-length (FL) APE1 in a pet28a vector was purchased from GenScript. The E96A/D210N ...
-
bioRxiv - Biophysics 2019Quote: Wild type rabbit skeletal regulatory light chain (RLC) insert (UniProtKB entry: MLRS_RABIT; P02608) was obtained from Genscript. Wild type chicken gizzard smooth muscle RLC (smRLC ...
-
bioRxiv - Microbiology 2021Quote: Both wild type and edited MARV NP 3’UTR coding sequences were synthesized by Genscript (Piscataway, NJ). For amplifying the remaining MARV UTRs purified total RNA from MARV infected THP1 cells at 24 hours post infection was used for cDNA synthesis ...
-
bioRxiv - Immunology 2022Quote: The spike – S1 peptide pools of Wuhan wild-type SAR-CoV2 were purchased from Genscript (cat # RP30027). The Peptivator peptide pools for the variant of concerns and B ...
-
bioRxiv - Microbiology 2023Quote: The codon-optimized sequence coding for the wild type (WT) N (stain Long) was syn-thetised (GenScript) and cloned in the pFastBac Dual vector under the control of the polyhedrin promoter at BamHI and SalI sites ...