Labshake search
Citations for GenScript :
1 - 50 of 566 citations for 6 N PHTHOLYL 2 N Z L LYSINE since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... The SARS-CoV-2 N gene was PCR amplified from plasmids pUC57-SARS-CoV-2-N (GenScript) using forward primers with T7 promoter and reverse primers with poly(T)34 sequences ...
-
bioRxiv - Microbiology 2023Quote: ... The SARS-CoV-2 N gene was PCR amplified from plasmids pUC57-SARS-CoV-2-N (GenScript) using forward primers with T7 promoter and reverse primers with poly(T)34 sequences ...
-
bioRxiv - Immunology 2023Quote: ... SARS-CoV-2 N and S1 proteins were obtained from Genscript and Sino Biological.
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant BRD4 N-terminal protein was purchased from GenScript (BRD4-N (49-460aa), His ...
-
bioRxiv - Pathology 2021Quote: ... the recombinant N protein was constructed by inserting the N gene of SARS-CoV-2 into the pGEX-6P vector (GenScript Japan, Tokyo, Japan). Next ...
-
bioRxiv - Microbiology 2020Quote: ... Antibodies against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript) and GAPDH of anti-GAPDH (Proteintech ...
-
bioRxiv - Biochemistry 2020Quote: ... or into pcDNA3.1-(+)-N-DYK (nsp2) to append an N-terminal FLAG tag (GenScript).
-
bioRxiv - Immunology 2020Quote: ... S1 and N proteins (Genscript) were conjugated onto MagPlex microsphere (Luminex ...
-
bioRxiv - Microbiology 2020Quote: ... Antibody against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript, USA) and GAPDH of anti-GAPDH (Proteintech ...
-
bioRxiv - Immunology 2021Quote: Biotinylated SARS-CoV-2 S1 protein and biotinylated SARS-CoV-2 N protein were purchased from GenScript. The biotinylated proteins were combined with different streptavidin (SA ...
-
bioRxiv - Immunology 2023Quote: ... and N (GenScript, Cat No. A02090) were included at high (30µg/mL ...
-
bioRxiv - Systems Biology 2021Quote: ... cell were stained overnight at 4°C with SARS-CoV-2 N-antibody (Genscript) at a dilution of 1:500 in PBS + 1% BSA+ 1%FBS ...
-
bioRxiv - Biochemistry 2021Quote: ... The linear peptides DMT1-II550-568 (AQPELYLLNTMDADSLVSR) and palmitoylated CI-MPR2347-2375 with N-terminal di-lysine (KKSNVSYKYSKVNKEEETDENETEWLMEEIQ) were both synthesised by Genscript (USA).
-
bioRxiv - Synthetic Biology 2023Quote: ... SpyTag peptide (N-term-AHIVMVDAYKPTKGSGDRCG-C-term, N-term: Acetylation, C-term: Amidation, purity: 94%, GenScript Biotech) was dissolved in triethanolamine (TEA ...
-
bioRxiv - Cell Biology 2020Quote: pCDNA3.1-GFP-Rab10 and pCDNA3.1-Flag-Rab10 were generated by insertion of synthesized Rab10 cDNA into pCDNA3.1+N-EGFP plasmid or pCDNA3.1+/N-DYK plasmid from Genscript as described 13 ...
-
bioRxiv - Cell Biology 2021Quote: ... was purchased from GenScript (ref. n° OHu13506). The Myc-mKCNJ2-T2A-IRES-tdTomato.lti (#978 ...
-
bioRxiv - Cell Biology 2020Quote: ... into pcDNA3.1+N-MYC plasmid from Genscript.
-
bioRxiv - Cell Biology 2022Quote: Pulldown with N-terminally biotinylated peptides (GenScript) was carried out as follows ...
-
bioRxiv - Biochemistry 2023Quote: ... N and M were synthesized by GenScript to more than 98% purity except for the surrogate peptide for full-length GPC which could only be purified to 66% ...
-
bioRxiv - Biochemistry 2023Quote: The Fis1 N-terminal arm peptide (MEAVLNEL) with N-terminal acetylation and C-terminal amidation were purchased from GenScript who determined the peptide to be >95% pure by HPLC ...
-
bioRxiv - Immunology 2023Quote: ... The biotinylated SARS-CoV-2 fusion peptide (N’-biotin-DPSKPSKRSFIEDLLFNKVT-C’) and His-tagged HIV Env MPER peptide (N’-NWFDITNWLWYIKSGGSHHHHHHHH-C’) were chemically synthesized by GenScript.
-
bioRxiv - Molecular Biology 2019Quote: ... YBX1 was cloned into pcDNA3.1+N-EGFP (Genscript) and pmCherry-C1 (Clontech ...
-
bioRxiv - Microbiology 2021Quote: ... N-terminus biotinylated peptides were synthesized by Genscript. N-terminal GSGS linker sequence was added to all peptide sequences ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... expressing N-terminally FLAG-tag (GenScript, Leiden, Netherlands). A selection of truncated versions of the AhR and ARNT was done based on previously published data [27,30] ...
-
bioRxiv - Cancer Biology 2023Quote: ... PLXNB2 OHu01778C_pcDNA3.1(+) N-Terminal Flag-Tag (GenScript #SC1626), PLXNB2 OHu01778D_pcDNA3.1+/C- C-Terminal Flag-Tag (GeneScript #OHu01778D) ...
-
bioRxiv - Biochemistry 2023Quote: N-terminal biotinylated peptides were synthesized by Genscript at ≥95% purity and dissolved in 100% DMSO to a stock concentration of 10 µg/µL ...
-
bioRxiv - Biochemistry 2023Quote: ... or pcDNA-(+)-N-DYK vector for nsp2 (Genscript). An N-terminal truncation nsp3.1-FT (residues 1-749 ...
-
bioRxiv - Biochemistry 2022Quote: Recombinant mEAK-7 from Sus scrofa (uniprot ID: A0A4X1T484) was synthesized in a pET28 vector with N-terminal 6×His tag (GenScript). ArcticExpress competent cells (Agilent ...
-
bioRxiv - Molecular Biology 2020Quote: Codon optimized Gcn5 (S. pombe) with 1 × FLAG was cloned into pET28a in frame with N terminal 6 × HIS tag by GenScript to generate JP-2587.
-
bioRxiv - Biochemistry 2022Quote: The gene encoding SARS-CoV-2 NSP3 Mac1 (residues 3-169) was cloned into a pET-22b(+) expression plasmid with a TEV-cleavable N-terminal 6-His tag (Genscript). The protein was expressed and purified as described previously (14).
-
bioRxiv - Immunology 2022Quote: The coding sequences for the extraviral domain of VARV A33 with N terminus 6×His tag and C-terminus Avi-tag were synthesized by GenScript and directly cloned into the PET-28a(+) ...
-
bioRxiv - Plant Biology 2020Quote: ... coli codon-optimized gene for Arabidopsis UVR8 was introduced into the pET11a expression vector generating a construct carrying an N-terminal 6×His-tag (Genscript). The construct was verified by DNA-sequencing and transformed into the E ...
-
bioRxiv - Microbiology 2023Quote: ... SARS-CoV-2 spikes or their N-to-Q or N-to-A substituted variants were codon optimized and cloned into pcDNA3.1(+) plasmid (GenScript, Piscataway, NJ). The HIV gag/pol (pCMVΔR8.2 ...
-
bioRxiv - Biochemistry 2022Quote: The coding sequence of MtDPP was cloned into plasmid pET28a(+)in frame with an N-terminal 6×His tag (GenScript™). BL21 (DE3 ...
-
bioRxiv - Biochemistry 2020Quote: ... or N-terminal poly-histidine-tag (Genscript, codon-optimized) was expressed in E ...
-
bioRxiv - Microbiology 2023Quote: ... anti-CsoS2-N (1:10,000 dilution; synthesized by GenScript, NJ ...
-
bioRxiv - Biophysics 2023Quote: ... and N (GenBank: NC_045512.2) genes were synthesized by Genscript, Inc ...
-
bioRxiv - Immunology 2019Quote: ... B10.RIII mice (female, 6 to 8 weeks old, n = 8) were immunized with 100 μg IRBP160-181 peptide (GenScript, Piscataway, N.J.) dissolved 100 μl PBS emulsified in 100 μl of complete Freund’s adjuvant ...
-
bioRxiv - Microbiology 2024Quote: ... followed by staining of cells with primary rabbit anti-SARS-CoV-2 N Wuhan-1 antibody (Genscript U739BGB150-5) (1:2000 dilution ...
-
bioRxiv - Biochemistry 2020Quote: ... N-terminal CSF and “tethered” peptides were synthesized by GenScript. Chimeric G protein yeast strains were provided by GSK under material transfer agreement.
-
bioRxiv - Biochemistry 2020Quote: ... and a C-terminal TAMRA label (N-AAARKKRRQRRR-C, Genscript), and MerMade-synthesized unlabeled HIV-1 TAR ...
-
bioRxiv - Immunology 2023Quote: ... Plasmids encoding N-terminal domain proteins were obtained from GenScript. Plasmids were transiently co-transfected in FreeStyle 293-F cells using 293Fectin (ThermoFisher) ...
-
bioRxiv - Immunology 2021Quote: ... Peptide pools consisted of 15-mer peptides overlapping by 11 amino acids and spanned the entire S and N proteins of SARS-CoV-2 (GenScript). After stimulation ...
-
bioRxiv - Immunology 2022Quote: ... Peptide pools consisted of 15-mer peptides overlapped by 11 amino acids and spanning the entire S and N proteins of SARS-CoV-2 (GenScript). After stimulation ...
-
bioRxiv - Immunology 2021Quote: ... were coated with 100 µL of SARS-CoV-2 RBD (1 µg/mL) (cat n° Z03479, GenScript, Piscataway, NJ, USA) and S1 subunit (0.5 µg/mL ...
-
Activation of endoplasmic reticulum stress via clustering of the inner nuclear membrane protein SUN2bioRxiv - Cell Biology 2022Quote: ... and SUN2-N-2 (AA 1-226) fragments by PCR from pcDNA3.1+/C-(K)DY-SUN2 vector (OHu01874,GenScript # NM_001199579.1) and subsequent cloning into MP029-CRY2-mCherry lentiviral vector using the NheI/XbaI restriction sites ...
-
bioRxiv - Immunology 2020Quote: A full-length nucleocapsid (N) phosphoprotein nucleotide sequence (1293 base-pairs) of the SARS-CoV-2 virus was optimized and synthesized (Genscript). The synthesized sequence was cloned into a PET-30a(+ ...
-
bioRxiv - Microbiology 2022Quote: ... pcDNA3.1 encoding CoV-2 Omicron (BA.1) Spike tagged with a His epitope on the N-terminus was synthesized provided by Genscript. pMD2.G encoding VSV-G (12259 ...
-
bioRxiv - Microbiology 2022Quote: ... were stimulated for 24 h with 15-mer overlapping peptides from SARS-CoV-2 spike glycoprotein (Cat no# PM-WCPV-S-1, JPT Peptide Technologies GmbH) or VSV-N (Genscript) at a concentration of 2.5 µg/mL ...
-
bioRxiv - Cancer Biology 2021Quote: ... that contains a N-terminal His TEV cleavage tag by Genscript. Protein expression was carried out in Escherichia coli C41(DE3) ...