Labshake search
Citations for GenScript :
1 - 50 of 711 citations for 4F2 Cell Surface Antigen Light Chain SLC7A5 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: Antibody heavy and light chain genes were synthesized by GenScript, separately inserted into vector plasmids (pCMV3-CH ...
-
bioRxiv - Microbiology 2022Quote: ... Heavy chain variable (VH) and light chain variable (VL) genes for each antibody were synthesized (GenScript), then transfected into Expi293 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: ... Heavy chain and light chain plasmids were obtained from GenScript. Expi293 cells (Life Technologies ...
-
bioRxiv - Immunology 2022Quote: Antibody heavy and light chain genes were optimized for human cell expression and synthesized by GenScript. VH and VL were inserted separately into plasmids (pCMV3-CH ...
-
bioRxiv - Immunology 2023Quote: Antibody heavy chain and light chain genes were synthesized and cloned into plasmids containing the CMV promoter (GenScript). Final heavy and light chain plasmids were amplified ...
-
bioRxiv - Microbiology 2022Quote: ... heavy chain variable (VH) and light chain variable (VL) genes were synthesized (GenScript), cloned into an expression vector ...
-
bioRxiv - Microbiology 2022Quote: ... The variable regions of heavy and light chains for each antibody were synthesized (GenScript), cloned into gWiz or pCDNA3.4 vector ...
-
bioRxiv - Molecular Biology 2021Quote: ... CB6 (heavy chain GenBank MT470197, light chain GenBank MT470196) was custom produced in a mammalian cell system by Genscript.
-
bioRxiv - Microbiology 2021Quote: ... by synthesis of heavy chain variable (VH) and light chain variable (VL) genes (GenScript), transfection of Expi293 cells (Thermo Fisher) ...
-
bioRxiv - Immunology 2023Quote: ... heavy and light chain genes were synthesized by GenScript, inserted separately into plasmids (pCMV3-CH ...
-
bioRxiv - Biophysics 2020Quote: ... Genes for the heavy and light chain of the CR3022 antibody were obtained from Genscript (USA) and cloned into the pcDNA3.4 vector
-
bioRxiv - Molecular Biology 2021Quote: ... and CV3018 heavy and light chains were ordered from GenScript and cloned into pCMV/R ...
-
bioRxiv - Immunology 2021Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Microbiology 2021Quote: ... CR3022 antibody heavy and light chain genes were synthesised and subcloned into pcDNA3.4 vector by Genscript (USA).
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Immunology 2021Quote: ... DH1017.IgG and DH1017.Fab heavy and light chain plasmids (GenScript) were co-transfected at an equal ratio in suspension Expi 293i cells (Invitrogen ...
-
bioRxiv - Immunology 2020Quote: Genes encoding CR3022 heavy and light chains were ordered from GenScript and cloned into pCMV/R ...
-
bioRxiv - Immunology 2023Quote: Heavy and light chain sequences were synthesized and cloned by Genscript into IgG1 ...
-
bioRxiv - Immunology 2021Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (Genscript) and used to transfect Expi293 cells (ThermoFisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (GenScript) and transfected into Expi293 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were similarly synthesized and cloned into the pcDNA3.1 vector (GenScript). Oligonucleotides were synthesized by IDT ...
-
bioRxiv - Immunology 2021Quote: Selected pairs of heavy and light chain sequences were synthesized by GenScript and sequentially cloned into IgG1 and Igκ/λ expression vectors ...
-
bioRxiv - Immunology 2021Quote: ... Plasmids for the P1-05 heavy and light chain were synthesized (Genscript) and cloned into pcDNA3.1+ ...
-
bioRxiv - Immunology 2020Quote: ... Immunoglobulin heavy and light chain sequences were synthesized and cloned by Genscript into IgG1 ...
-
bioRxiv - Immunology 2022Quote: ... Matched pairs of antibody VH and Vλ/Vκ sequences were commercially cloned into plasmids containing an IgG1 or relevant light chain backbone and expressed as recombinant antibody (Genscript). mAbs were also expressed in-house by transient transfection of Expi293 cells (Gibco ...
-
bioRxiv - Immunology 2022Quote: ... lambda and kappa light chains genes were cloned into a pCDNA3.4 vector (Genscript) and expressed in Expi293 cells as described above.
-
bioRxiv - Microbiology 2021Quote: Genes encoding CV30 and CR3022 heavy and light chains were ordered from GenScript and cloned into pCMV/R ...
-
bioRxiv - Immunology 2022Quote: ... paired heavy (VDJ) and light (VJ) chain variable gene sequences were commercially synthesized (GenScript) and cloned into antibody expression plasmids (see Table S4E for GenBank accession numbers of heavy and light chain variable regions) ...
-
bioRxiv - Immunology 2023Quote: Antibody variable heavy and light chain regions were synthesized by gene synthesis with appended N-terminal signal sequences (Genscript Biotech, Piscataway, NJ) and subcloned into IgG1 or lambda or kappa light chain based PCDNA3.1 mammalian expression plasmids ...
-
bioRxiv - Immunology 2021Quote: ... plasmids encoding cDNAs for the heavy and light chain sequences of PhtD3-IgG2a were synthesized (GenScript), and cloned into pCDNA3.1+ ...
-
bioRxiv - Microbiology 2024Quote: ... The murine-human chimeric heavy and light chain sequences were then cloned into pGenDONR by GenScript, with a P2A sequence added between the heavy and light chain sequences to create the pGenDONR-IgG H1-P2A-Ig(λ ...
-
bioRxiv - Biophysics 2019Quote: Wild type rabbit skeletal regulatory light chain (RLC) insert (UniProtKB entry: MLRS_RABIT; P02608) was obtained from Genscript. Wild type chicken gizzard smooth muscle RLC (smRLC ...
-
bioRxiv - Immunology 2022Quote: ... Fab or IgG1 heavy and light chain genes were codon-optimized and synthesized by GenScript (Piscataway, NJ).
-
bioRxiv - Immunology 2020Quote: ... plasmids encoding cDNAs for the heavy and light chain sequences of 101F,64 MPE8,49 and DS747 were synthesized (GenScript), and cloned into vectors encoding human IgG1 and lambda or kappa light chain constant regions ...
-
bioRxiv - Microbiology 2020Quote: The IgG heavy and light chain variable genes of CB6 mAb (GenBank: MT470196 and MT470197) were human codon-optimized and synthesized by Genscript and cloned into antibody expression vectors.
-
bioRxiv - Immunology 2022Quote: ... The antibody expression constructs containing the heavy-chain and the light-chain variable region exons, with human constant region sequences (IgG1, Igκ) at the C terminus were made by Genscript. Monoclonal antibodies were generated using the Expi293 expression system (Thermo Fisher Scientific ...
-
bioRxiv - Immunology 2023Quote: The wild-type MHC-I heavy chain tagged with BSP and the β2m light chain were provided by the NIH (Emory university) or synthesized and cloned into pET-22b(+) vector (Genscript). For the open constructs ...
-
bioRxiv - Microbiology 2022Quote: ... and polyclonal αcGAS antibodies were purified by antigen affinity (GenScript). Serum was used at 1:30,000 for cGAS detection ...
-
bioRxiv - Cancer Biology 2021Quote: ... the melanoma cells were spiked with gp100+ antigens (GenScript) just before addition of T-cells ...
-
bioRxiv - Microbiology 2022Quote: ... and DNA was synthesized and cloned in-framed into pcDNA-based vectors containing a human IgG1 constant region and a human kappa light chain constant region (GenScript USA Inc., Piscataway, NJ).
-
bioRxiv - Developmental Biology 2020Quote: ... Antigen for the custom anti-Nrl antibody (commissioned from Genscript, Piscataway, NJ, USA) was recombinant protein matching the C-terminal 112 amino acids of zebrafish Nrl (residues 301-412 of GenBank ...
-
bioRxiv - Microbiology 2020Quote: ... EsxA and SodA were generated for this study (Customer’s Antigen Polyclonal Antibody Package, Genscript). C-terminally his6-tagged SiEsaA41-871 ...
-
bioRxiv - Biochemistry 2019Quote: ... Surface expression was measured by incubating cells with 200uL TMB (Genscript) per well and reaction was stopped by transferring 100uL of developed colored solution to a 96-well plate already containing 100uL of 1M H2SO4 ...
-
bioRxiv - Immunology 2023Quote: The antibody heavy chain genes of matured AIIMS-P01 lineage antibody was synthesized after codon-optimization for mammalian expression from Genscript, Inc ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2023Quote: ... or 9 ug/mL of full-length FimH protein (antigen for custom antibody production, Genscript) was used.
-
bioRxiv - Immunology 2024Quote: ... G12V-TCR alpha chain (1-206) and G12V-TCR beta chain (1-246) were synthesized by Genscript (USA) and cloned into the pET30a+ vector ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... we used custom polyclonal antibodies raised against recombinant fragment antigens generated by rabbits’ immunization (GenScript, Piscataway Township, NJ, USA). Each recombinant fragment was injected into three rabbits ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Light chain of CTX/ATZ antibody and heavy chain fused with EndoTag at C-term constructs were ordered in CMVR from Genscript. Antibody-EndoTag fusions were then expressed via transient co-transfection of the EndoTag-heavy and light chains into Expi293F cells (Life Technologies ...
-
bioRxiv - Microbiology 2020Quote: Commercially produced purified antigens were supplied by GenScript as follows ...