Labshake search
Citations for GenScript :
2801 - 2850 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... or the Toxoplasma specific peptides AS15 and ROP5 (custom made, Genscript) for 4 hours ...
-
bioRxiv - Evolutionary Biology 2022Quote: Protein G (5 μg/ml, 50 μl/well; Genscript, China, Z02007) was diluted to 5 μg/ml with PBS (0.01 M ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... The Hdp1opt and Hdp1opt L27Q proteins used for the in vitro experiments were synthesized by GenScript and resuspended in water for a stock concentration of 1 mg/ml.
-
bioRxiv - Evolutionary Biology 2022Quote: DNA library containing seven random nucleotides was designed and cloned into pUC18 plasmid by Genscript. This random library was transformed in XL1blue E ...
-
bioRxiv - Immunology 2022Quote: For immunoprecipitation, 10×106 human peripheral blood monocytes cells were treated with SARS-CoV-2 Spike protein (RBD, His Tag) (GenScript) 100 ng/ml for 2 hours ...
-
bioRxiv - Immunology 2022Quote: ... for 30 minutes before adding 100 ng/mL of Sars-CoV-2 spike protein (RBD, HisTag) (Cat. ZO3483-1-GenScript) or infected using Heat-inactivated SARS-CoV-2 (VR-1986HK ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom synthesized and subcloned into pET28 vector (Genscript). The plasmid was transformed in BL21 Star™ (DE3 ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... The mouse ASIC1a subunit was synthesized by GenScript (new Jersey, USA) with SacI and BamHI restriction sites flanking the start and stop codons ...
-
bioRxiv - Genetics 2022Quote: The SpyTag stock solution was prepared by dissolving synthetic SpyTag (Genscript custom peptide synthesis service) in water at a concentration of 1mM ...
-
bioRxiv - Genetics 2022Quote: The designed 3 pegRNA sequences were synthesized with the pU6 promoter by GenScript and cloned into the lentiviral pHIV-EGFP (Addgene ...
-
bioRxiv - Genetics 2022Quote: ... The designed pegRNA sequences were synthesized with the pU6 promoter by GenScript and cloned into the plasmid pHIV-EGFP (Addgene ...
-
bioRxiv - Immunology 2022Quote: ... NL63 (YP_003767.1) and WIV-1 (Uniprot – U5WI05) were synthesized from Genscript. HIV-based HcoV spike glycoprotein-pseudotyped viruses were prepared as previously described (70 ...
-
bioRxiv - Immunology 2022Quote: ... 5 μl of a synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), eBioscience Cell Stimulation Cocktail (Fisher Scientific 00-4975-93 ...
-
bioRxiv - Immunology 2022Quote: ... all synthesized by GenScript) ...
-
bioRxiv - Immunology 2022Quote: ... et al (HPV16 E7) and Drakes et al (NY-ESO-1, 1G4 and MART-1, DMF5) were ordered from GenScript in the MSGV-retroviral vector (33 ...
-
bioRxiv - Immunology 2022Quote: ... Retroviral vectors were ordered from GenScript and used to transfect Phoenix Eco cells using the Lipofectamine™ 3000 Transfection Reagent and protocol (ThermoFisher ...
-
bioRxiv - Immunology 2022Quote: ... The following peptides were used for T cell stimulation in ICS assays: Trp1 (NTPQFENL, GenScript), Trp2 (SVYDFFVWL ...
-
bioRxiv - Immunology 2022Quote: ... and checked for endotoxins levels using the ToxinSensor™ Chromogenic LAL Endotoxin Assay Kit (GenScript).
-
bioRxiv - Immunology 2022Quote: ... at 20 mg/ml were mixed with the fusion peptide (KPSKRSFIEDLLFNK, GenScript) at 20 mM and incubated for 2 h at room temperature before setting up crystallization plates ...
-
bioRxiv - Immunology 2022Quote: ... The gene to express SARS-CoV-2 S2 PentaPro in prefusion conformation was synthetized by GenScript residues 686 to 1211 fused C-terminally to a foldon trimerization domain and His-tagged ...
-
bioRxiv - Immunology 2022Quote: The concentration of endotoxin in CXCL4 stock solutions was measured by Chromogenic LAL Endotoxin Assay Kit (GenScript, cat. No: L00350C) according to the manufacturer’s instructions.
-
bioRxiv - Immunology 2022Quote: ... An hMPV F B2 (strain TN99-419) version of this construct was synthesized by GenScript. Protein expression was carried out using FreeStyle 293F cells (ThermoFisher ...
-
bioRxiv - Microbiology 2022Quote: ... α-CrPV-VP2 (1:1000, Genscript), α-CrPV-3C (1:1000 ...
-
bioRxiv - Microbiology 2022Quote: ... The polyclonal antibody against CrPV-1A in rabbits was generated by Genscript. USA.
-
bioRxiv - Immunology 2022Quote: ... the standard curve was run using an IgG1 SARS-CoV-2 neutralizing antibody (GenScript) for full quantification ...
-
bioRxiv - Immunology 2022Quote: ... VRC42.01 and 4E10 were synthesized by GenScript (Hong Kong, China) and subcloned into a SEK vector ...
-
bioRxiv - Immunology 2022Quote: ... Bound IgG was detected as the luminescence signal at 425 nm using an HRP-conjugated anti-human IgG (H&L) secondary antibody (Genscript) and SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Fisher Scientific).
-
bioRxiv - Immunology 2022Quote: ... A SARS-CoV-2 neutralizing monoclonal antibody (mAb; GenScript, Piscataway, NJ; #A02057), was used as a positive control at a known starting concentration of 3.2 ng/µL followed by serial 1:2 dilutions similarly to each sample and negative control ...
-
bioRxiv - Immunology 2022Quote: ... and recombinant nucleocapsid protein (GenScript Z03488). The next day ...
-
bioRxiv - Immunology 2022Quote: ... 6 and 8 were analyzed with the cPass™ SARS-CoV- 2 neutralization antibody detection kit (GenScript, Cat #L00847) to detect any antibodies that neutralize the interaction between the RBDdelta and the ACE2 receptor ...
-
bioRxiv - Microbiology 2022Quote: ... and the supernatants were subjected to incubation with streptavidin resin (GenScript) (50 μL/dish ...
-
bioRxiv - Immunology 2022Quote: ... A total of 500,000 splenocytes were restimulated ex vivo with the full-length SARS-CoV-2 B.1.1.529 S 15-mer (overlapping by 11 amino acids) peptide pool (GenScript) in plates pre-coated with anti-IFN-γ or anti-IL-4 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... and V987P) was codon optimized using GenSmart codon optimization algorithm (GenScript). The optimized DNA sequence was synthesized (Twist Bioscience) ...
-
bioRxiv - Immunology 2022Quote: ... binding of SARS-CoV2 and control IgG antibodies (at 1 µg/ml) to 15-mer S2 overlapping 5-amino acid peptides (n=52, GenScript Biotech, 500 ng/well) was tested using the same procedure as previously described (Wardemann ...
-
bioRxiv - Developmental Biology 2022Quote: ... The library was verified through next generation sequencing by GenScript. For lentivirus packaging ...
-
bioRxiv - Immunology 2022Quote: Fusion peptides were synthesized by GenScript. The complex of each Fab with peptide was formed by mixing each Fab with a 10-fold molar ratio of peptide and incubating overnight at 4°C without further purification ...
-
bioRxiv - Immunology 2022Quote: ... and PdCoV0081-4 ( Accession # MW685622.1, aa1-1092 with E854P and V855P mutations) were synthesized and cloned into pCDNA3.1- vectors (Genscript) with the following C-terminal modifications ...
-
bioRxiv - Immunology 2022Quote: ... nanobodies containing human IgG1 Fc in the culture supernatant were captured by AmMag Protein A Magnetic Beads (Genscript L00695) and eluted by Glycine pH 3.0 ...
-
bioRxiv - Immunology 2022Quote: ... HCoV-NL63 (GenBank: Q6Q1S2.1) and HCoV-229E (GenBank: AOG74783.1) were synthesized (Genscript), cloned into the mammalian expression vector VRC8400 (48 ...
-
bioRxiv - Immunology 2022Quote: ... and COV91-27 were codon optimized (Genscript) and fused with an N-terminal secreting signal peptide ...
-
bioRxiv - Immunology 2022Quote: ... The relMtb gene was codon-optimized (Genscript) and fused to the mouse MIP-3α gene ...
-
bioRxiv - Immunology 2022Quote: ... OLP peptide pools of 15mers with 11 amino acid overlap were generated spanning the SARS-CoV-2 Spike RBD (R319-S591, GenScript). Sequences that contained VOC mutations were exchangeable with the corresponding mutated peptides due to a modular OLP pool design.
-
bioRxiv - Immunology 2022Quote: The variants of concern of SARS-CoV-2 spike protein genes were optimized using mammalian codon and synthesized by Genscript, then cloned into pcDNA3.1(+ ...
-
bioRxiv - Immunology 2022Quote: ... 5 μl synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), or 5 μl heat-killed bacteria in PBS ...
-
bioRxiv - Immunology 2022Quote: ... vaccines consisted of 10 µg SARS-CoV-2 Spike RBD WH-01 protein (GenScript, cat# Z03483), combined with 1 nmol AMP-CpG-7909 (AMP-CpG ...
-
bioRxiv - Immunology 2022Quote: ... vaccines consisted of either SARS-CoV-2 Spike RBD WH-01 protein (GenScript; cat# Z03483) or SARS-CoV-2 WH-01 Spike protein (Acro Biosystems ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Developmental Biology 2022Quote: ... A custom CRISPR gRNA library pool containing 2159 gRNAs was designed and synthesized by GenScript (Piscataway, NJ). The PCR products were amplified and ligated into the pLentiGuid-Puro vector through BsmBI restriction via GenBuilderᵀᴹ Plus assembly ...
-
bioRxiv - Immunology 2022Quote: ... coli codon usage preference and synthesized by GenScript (Piscataway, NJ, USA), followed by subcloning into the pET41a using NdeI/XhoI restriction sites ...
-
bioRxiv - Immunology 2022Quote: ... and GAPDH (A00084, GenScript) (Supplementary Table 6) ...