Labshake search
Citations for GenScript :
2251 - 2300 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... The primers designed with mutations were ordered from Genscript Biotech ...
-
bioRxiv - Biophysics 2023Quote: ... The TRAK1-KIF5B complex was then eluted via prescission protease (GenScript) and subjected to SDS-PAGE.
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-rat kangaroo-Kid (3μg/ml, Genscript). The anti-rat kangaroo Kid was raised against the full Kid protein translated from the coding sequence obtained from the PtK transcriptome (Udy et al. ...
-
bioRxiv - Microbiology 2023Quote: ... coli was prepared by GenScript (NJ, USA). Samples (lysate containing 25 µg total protein or 16 µL supernatant fraction prepared as described in the previous section ...
-
bioRxiv - Microbiology 2023Quote: The full-length HgmTad2 and AcrIIA11 gene was synthesized by GenScript and amplified by PCR and cloned into pGEX6p-1 to produce a GST-tagged fusion protein with a PreScission Protease cleavage site between GST and the target protein ...
-
bioRxiv - Microbiology 2023Quote: ... 1 × 106 splenocytes were plated into each well of a 96-well flat-bottom plate and either left untreated or treated with 1 ug/ml p56 (AGPHNDMEI) or p79 (TSINFVKI) peptides (Genscript, Piscataway, NJ) for 5 h at 37°C in the presence of Brefeldin A (BD Cytofix/Cytoperm ...
-
bioRxiv - Microbiology 2023Quote: ... affinity-purified rabbit polyclonal (peptide SSTEPASTGTPSSGC, produced by GenScript, 1:1000), followed by donkey anti-rabbit Alexafluor555 (Invitrogen A31572 ...
-
bioRxiv - Microbiology 2023Quote: ... Fusion proteins were generated for the assay by cloning chlamydial DNA sequences encoding CPAF into a pET30a vector (constructed by Genscript Biotech), resulting in fusion proteins with a hexahistidine (His6 ...
-
bioRxiv - Immunology 2023Quote: ... The genes were synthesized by Genscript and subcloned into SFG gamma-retroviral vectors ...
-
bioRxiv - Microbiology 2023Quote: ... and pEX18Gm (ampG) were constructed by digesting the gBlock inserts in pUC57 (Genscript) with EcoRI and HindIII (or SacI for ampG) ...
-
bioRxiv - Immunology 2023Quote: Antibody variable heavy and light chain regions were synthesized by gene synthesis with appended N-terminal signal sequences (Genscript Biotech, Piscataway, NJ) and subcloned into IgG1 or lambda or kappa light chain based PCDNA3.1 mammalian expression plasmids ...
-
bioRxiv - Immunology 2023Quote: ... heavy and light chain genes were synthesized by GenScript, inserted separately into plasmids (pCMV3-CH ...
-
bioRxiv - Molecular Biology 2023Quote: ... Afp18N20EtA (Afp18N20EtA: MPYSSASKAKATHSKATARD, glutamic acids to alanines) were synthesized and subcloned into pET11a_afp18NT20-casΦ-2 (replacing afp18NT20) by Genscript.
-
bioRxiv - Synthetic Biology 2023Quote: The expression levels of his-tagged nanobodies resulting from microfermentations were quantified using the His tag ELISA detection kit (GenScript, Cat# L00436) according to the manufacturer’s protocol ...
-
bioRxiv - Synthetic Biology 2023Quote: ... using an anti-Histidine-tag primary antibody (Genscript A00186; 1:3000 dilution) and an IR800 conjugated secondary antibody (Li-Cor Biosciences) ...
-
bioRxiv - Cell Biology 2023Quote: ... were synthesized in pUC57 at the EcoRV site by Genscript (Piscataway, NJ). The upstream homology arm sat at the end of the coding portion of the gene but eliminated the termination codon ...
-
bioRxiv - Biochemistry 2023Quote: ... and gene synthesis (Genscript, Piscataway, NJ) were used to mobilize the coding sequence and produces in-frame fusions of the desired proteins with the affinity tags or fluorescent tags ...
-
bioRxiv - Biochemistry 2023Quote: ... and α-CBP tag (GenScript, catalog # A00635 ...
-
bioRxiv - Biochemistry 2023Quote: ... The plasmids were constructed commercially (Genscript) and linearized by the appropriate Type IIS enzyme (BspQI or BsmBI ...
-
bioRxiv - Biophysics 2023Quote: Peptides were produced by Genscript to >95% purity with no additional modifications or capping beyond addition of spin labelled cysteines at the sites noted ...
-
bioRxiv - Biophysics 2023Quote: All HP1α tagged constructs with a 6x-His tag on the N-terminus were ordered from Genscript. Rosetta competent cells (Millipore Sigma 70954 ...
-
bioRxiv - Biophysics 2023Quote: ... and 10 μM rat 26RFa (GenScript) were added into the cell lysis and incubated at room temperature (RT ...
-
bioRxiv - Cell Biology 2023Quote: The open reading frame of full-length human GPNMB (NM_001005340.2) cloned into pcDNA3.1-C-EGFP was purchased from GenScript. pcDNA3.1-GPNMB-EGFP-G375V ...
-
bioRxiv - Biochemistry 2023Quote: ... The resulting lysate was centrifuged at 12,000 x g to separate the soluble protein fraction and incubated with glutathione resin (GenScript) for 30 minutes while shaking at room temperature (RT) ...
-
bioRxiv - Biochemistry 2023Quote: ... The supernatant was incubated with 2 mL of nickel resin (GenScript) at RT for 20 minutes and washed once with lysis buffer and another three times with wash buffer (20 mM Tris-Cl pH8.8 ...
-
bioRxiv - Biochemistry 2023Quote: ... His-ERK was further purified using 1 mL glutathione resin (GenScript) to remove any residual GST-tagged MKK1.
-
bioRxiv - Genomics 2023Quote: ... LoxP-Stop-LoxP and ORF1 (GenScript) sequences ...
-
bioRxiv - Developmental Biology 2023Quote: ... Wild type or a mutant version of the human PDX1 enhancer with 6 CisBP predicted RFX binding motifs mutated (Weirach et al 2014) were commercially synthesized by Genscript (Genscript USA, Piscataway, NJ) and cloned into the pGL4.23 firefly luc2/miniP vector (Promega E8411) ...
-
bioRxiv - Immunology 2023Quote: ... The supernatant was then incubated with 2-5 ml of FLAG Affinity resin (GenScript, Nanjing, China) for 1 h at 4°C ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Microbiology 2023Quote: ... were synthesized (Genscript) and cloned into a custom pcDNA3.4 (ThermoFisher ...
-
bioRxiv - Immunology 2023Quote: ... the HLA-E:A*02 construct (leader sequence MAVMAPRTLVLLLSGALALTQTWA) from Genscript was designed and expressed in a similar fashion38 ...
-
bioRxiv - Synthetic Biology 2023Quote: ... and 1 µM ɑ-factor (GenScript), DIX60 (Mam2 ...
-
bioRxiv - Synthetic Biology 2023Quote: ... 50,000 cells were transferred to 300 µL volumes comprising a 10-fold dilution series of ɑ-factor (0-100 µM) (GenScript) dissolved in SC+1%DMSO ...
-
bioRxiv - Synthetic Biology 2023Quote: ... cultures were diluted 50-fold by transfer to 200 µL volumes comprising a 10-fold dilution series of ɑ-factor (0-100 µM) (peptide-seq.: WHWLQLKPGQPMY) (GenScript) in SC+1%DMSO ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Codon optimizations for stated genes were performed by the Gensmart™ Codon Optimization Tool (GenScript, Piscataway, NJ).
-
bioRxiv - Synthetic Biology 2023Quote: ... ADDobody constructs were gene-synthesized (Genscript) and ligated into the pPROEX-HTB vector (Invitrogen ...
-
bioRxiv - Synthetic Biology 2023Quote: ... The resulting gene encoding for the Chimera PBP was synthesized (Genscript), and inserted into plasmid pACEBac1 (Geneva Biotech SARL ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Some recombinants were generated by homologous recombination using GenBuilder Kit (GenScript Biotech Corporation) following manufacturer’s instructions.
-
bioRxiv - Synthetic Biology 2023Quote: ... diluted to OD of 0.1 – 0.3 and stained with THETM iFluor 647 HA Tag antibody (GenScript; 1:500 – 1:1,000 dilution of 0.5 mg/ml stock in 10 mg/ml BSA ...
-
bioRxiv - Plant Biology 2023Quote: ... α-pS143 (GRDPSPQWEPKNSYD) were generated by GenScript (Piscataway, NJ, USA) and used at 1:4000 dilution in 1% BSA to detect proteins isolated from soybean root hair ...
-
bioRxiv - Biochemistry 2023Quote: ... Synthetic peptides corresponding to Npm2 A2 and glutamylated counterparts were obtained from GenScript (Piscataway, NJ). The Npm2 119-146aa peptide was purified as previously described 9 ...
-
bioRxiv - Biochemistry 2023Quote: The operon encoding LT from ETEC strains of porcine origin (also known as pLT) was synthesized by Genscript® with LT-IIB signal sequences ...
-
bioRxiv - Biochemistry 2023Quote: ... coli and cloned into pET26b(+) by GenScript® (Leiden ...
-
bioRxiv - Immunology 2023Quote: ... 5×105 cells per well (6 well plate) were stimulated with 100 ng/mL of IFN-γ (Z02916, Genscript) for 0 h ...
-
bioRxiv - Microbiology 2023Quote: ... PCR products were purified using the QuickClean 5M PCR Purification Kit (GenScript, Piscataway, NJ, USA). NanoDrop ND-100 Spectrophotometer (NanoDrop Technologies ...
-
bioRxiv - Biochemistry 2023Quote: Wildtype and mutant PRD-0038 S constructs consisting of residues 1-1235 and containing a 21 residue C-terminal deletion (del21) followed by a 3x FLAG tag were synthesized by GenScript and placed into an HDM plasmid ...
-
bioRxiv - Microbiology 2023Quote: Genes encoding His-tagged ectodomain versions of the HSV-1 gD receptors HVEM (HVEM200t) or nectin-1 (nectin345t) were synthesized by GenScript (GenBank accession numbers AF060231 and U70321 ...
-
bioRxiv - Immunology 2023Quote: All proteins were custom-made by GenScript HK Limited ...
-
bioRxiv - Cancer Biology 2023Quote: ... 4-12% gel (GenScript, #M00654) and separated by MOPS buffer (GenScript ...