Labshake search
Citations for GenScript :
1651 - 1700 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Evolutionary Biology 2023Quote: ... was also acquired from GenScript. This cDNA was subsequently cloned in-frame into the EcoRI and SalI sites of the pGST-Parallel-1 vector (Sheffield et al ...
-
bioRxiv - Cell Biology 2023Quote: ... and synthetic genes were purchased from GenScript. All four ORFs were insertent to a GoldenBac plasmid (pGB ...
-
bioRxiv - Cell Biology 2023Quote: To generate GFP-TBK1 constructs the insect codon optimized TBK1 gene was purchased from GenScript and cloned with respective tags into pFastBac_Dual (Table S4) ...
-
bioRxiv - Plant Biology 2023Quote: ... PCC7001 (IMG ID: 647590134, CPCC7001_1784 and IMG ID: 647590133, CPCC7001_1671, respectively) were synthesized (GenScript, New Jersey, USA) and inserted into the SacI/XbaI restriction sites of plasmids pSE2-1 and pSE4-1 which both carry a spectinomycin resistance (spR ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... the cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mM and reacted with 10 μM Alexa-Fluor 647-maleimide (Invitrogen ...
-
bioRxiv - Microbiology 2023Quote: ... Genes encoding pyocin SX1 and SX2 and associated immunity proteins (GenBank records ON716475-ON716476) were codon optimized and synthesized (GenScript, USA) for expression in E ...
-
bioRxiv - Microbiology 2023Quote: ... Total protein was quantified using a BCA assay and 50 μg of each sample was prepared for loading onto 12% precast PAGE gels (GenScript). Wet transfers were performed onto 0.45 uM pore-sized PVDF membranes (Immobilon) ...
-
bioRxiv - Microbiology 2023Quote: ... Novel plasmids were synthesized by Genscript (Piscataway, NJ, USA). We built a FVV expressing β-galactosidase with a nuclear localization signal (puc2MD9-B-GAL ...
-
bioRxiv - Microbiology 2023Quote: Plasmid pBLS820 was custom produced by GenScript (Piscataway, NJ) by cloning the B ...
-
bioRxiv - Microbiology 2023Quote: ... custom synthesized by GenScript. B ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... and 500 µM Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and crosslinked at a 0.6 VS to thiol ratio with di-thiol matrix metalloproteinase sensitive peptide (GenScript ...
-
bioRxiv - Biochemistry 2023Quote: Substrates were custom synthesized by GenScript and dissolved in DMSO to 10 mM (Ac-GWYL-amc ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... and crosslinked at a 0.6 VS to thiol ratio with di-thiol matrix metalloproteinase sensitive peptide (GenScript) plus 10 μM AlexaFluor-647 (ThermoFisher) ...
-
bioRxiv - Plant Biology 2023Quote: ... Solid-phase chemical peptide synthesis of GFP11 and CPP fusions was performed by a third-party manufacturer (GenScript). Enzymes used for cloning reactions were procured through New England Biolabs ...
-
bioRxiv - Biochemistry 2023Quote: A pFastBac vector (GenScript) incorporating the wild type human CaMKIIɑ isoform 2 gene at cloning site BamHI-Xhol was transformed into chemically competent DH10Bac cells and plated on TKG (Tetracycline ...
-
bioRxiv - Biochemistry 2023Quote: ... The supernatant was incubated with anti-FLAG affinity resin (GenScript) on a rotator for 2 hours ...
-
bioRxiv - Biochemistry 2023Quote: ... including mutation C2332T to avoid oxidation problems) was optimized for expression in bacteria and synthesized by Genscript. It was cloned in a pET-22b vector ...
-
bioRxiv - Biochemistry 2023Quote: The ThPlsB protein was expressed in E coli C41(DE3) cells by using pET 21b vector with synthesized cDNA (codon optimized through the GenSmart system from GenScript). The LB media with 0.1 mg mL−1 ampicillin were used for cell culture ...
-
bioRxiv - Biochemistry 2023Quote: ... Strep (Genscript A01732, 1: 5,000), c-myc (Invitrogen 13-2500 ...
-
bioRxiv - Biochemistry 2023Quote: The UTX long isoform cDNA was purchased from Genscript (CloneID OHu24601). The cDNA for UTX lacking exon 14 sequences was PCR amplified from pCMV-HA-UTX ...
-
bioRxiv - Molecular Biology 2023Quote: ... or were synthesized by Genscript. Complete sequences for all reporters can be found in the Supplemental Material.
-
bioRxiv - Neuroscience 2023Quote: ... an expression plasmid of pcDNA3.1(+)-SCN10A-Furin-P2A-SCN2B was constructed (Genscript) in which a CMV promoter transcribes human NaV1.8α and Na²2 from a single open reading frame (ORF ...
-
bioRxiv - Biochemistry 2023Quote: The peptides for this study were purchased from Genscript Biotech (Rijswijk ...
-
bioRxiv - Biochemistry 2023Quote: ... Importinβ and IBB-mCherry in pET11a (Genscript) were expressed as His-fusion proteins in E ...
-
bioRxiv - Biochemistry 2023Quote: ... coupled to a Gly-Gly-Gly-Cys peptide (Genscript). The next morning ...
-
bioRxiv - Biochemistry 2023Quote: ... The samples were analyzed by SDS-PAGE and immunoblotting with anti-Flag (anti-DYKDDDDK, Genscript), anti-HA (clone 3F10 ...
-
bioRxiv - Biochemistry 2023Quote: ... immunoblotted with anti-DYKDDDK (Genscript) and Mouse IgG HRP-linked whole Ab (Cytiva) ...
-
bioRxiv - Bioengineering 2023Quote: ... plantarum NCIMB8826 strain harboring helper plasmid pLH01 was induced with 100 ng/ml Sakain P peptide (GenScript) for RecE/T expression and was subsequently prepared as competent cells ...
-
bioRxiv - Biochemistry 2023Quote: ... smegmatis gene MSMEG_3935 encoding RafH protein was commercially synthesized from GenScript and cloned in the pET-28a(+ ...
-
bioRxiv - Biochemistry 2023Quote: ... or pcDNA-(+)-N-DYK vector for nsp2 (Genscript). An N-terminal truncation nsp3.1-FT (residues 1-749 ...
-
bioRxiv - Biochemistry 2023Quote: ... and orf8-FT (Wuhan-Hu-1 MN908947) were codon-optimized and cloned into a pcDNA-(+)-C-DYK vector (Genscript) or pcDNA-(+)-N-DYK vector for nsp2 (Genscript) ...
-
bioRxiv - Immunology 2023Quote: ... and PGT151 and 1-18 IgGs were produced by Genscript based on publicly available sequences.
-
bioRxiv - Biochemistry 2023Quote: ... the expression levels of each mutant series and their wild-type version were normalized for comparison purposes by quantitation via western blots against the 6xHis tags present at the C-termini of all constructs (Antibody: anti-His-Tag Antibody coupled with iFlour 488, Genscript, A01800, 1:500 dilution). Quantitation of fluorescent signal was performed using a Biorad Chemidoc system and ImageLab version 6 (Biorad).
-
bioRxiv - Biophysics 2023Quote: Peptides were synthesized with C-terminal amidation (to reduce unwanted charge effects at the carboxy terminus) to generate wild-type and variants of the 17 N-terminal residues of CXCL12 (KPVSLSYRCPCRFFESH) (GenScript Biotech), a peptide known to elicit calcium mobilization and Gαi coupling signaling20 ...
-
bioRxiv - Biochemistry 2023Quote: ... We decanted the supernatant and mixed with Ni-NTA resins (GenScript). We loaded the resins to a column ...
-
bioRxiv - Biochemistry 2023Quote: ... Codon optimized sequences (GenScript Biotech, Netherlands) were used for overexpression in S ...
-
bioRxiv - Immunology 2023Quote: sgRNAs (PD-L1: 5’TCTTTATATTCATGACCTAC; CD155: 5’CCCGAGCCATGGCCGCCGCG) were chemically synthesized (GenScript). Ribonucleoproteins (RNPs ...
-
bioRxiv - Microbiology 2023Quote: Plasmid encoding TelE with the C-terminus fused with superfolder GFP was constructed by splicing the PCR amplicons corresponding to the telE open reading frame without a stop codon and the superfolder GFP open reading frame that has been codon-optimized for SGG (gene synthesized at GenScript).
-
bioRxiv - Physiology 2023Quote: ... and a TAT-scrambled pep213 (YGRKKRRQRRRGSGSGSPLLHFHPSHDLYPK) were all purchased from Genscript (Piscataway, NJ) with N-terminal acetylation and C-terminal amidation which were determined to be >95% purity by HPLC ...
-
bioRxiv - Biochemistry 2023Quote: ... Peptides AMA1 and PHA1 were chemically synthesized by GenScript Biotech (USA) ...
-
bioRxiv - Biochemistry 2023Quote: ... Follower and leader (clasp domain) peptides were synthesized by Genscript.
-
bioRxiv - Bioengineering 2023Quote: ... The cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase-sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) GenScript ...
-
bioRxiv - Bioengineering 2023Quote: ... Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and RGD (Ac-RGDSPGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) in 0.3 M triethylamine (Sigma ...
-
bioRxiv - Biochemistry 2023Quote: The 50-residue synthetic peptide used in Figure 3 was synthesized by GenScript USA Inc ...
-
bioRxiv - Biochemistry 2023Quote: ... genes flanked by BamHI and HindIII sites were codon-optimized for expression in budding yeast (Figures S1A and S1B) (GenScript; Piscataway, NJ). Codon-optimized γ1-actin (ACTG1 ...
-
bioRxiv - Microbiology 2023Quote: ... psme1 was amplified from pCMV-3Tag-4a::psme1 (purchased from Genscript, Piscataway, New Jersey) using Psme1Sal1-F/Psme1BamHI-R primer pairs (Table S4 ...
-
bioRxiv - Cell Biology 2023Quote: ... and probe libraries were ordered from Genscript (Precise Synthetic Oligo Pools) and amplified (see below).
-
bioRxiv - Biochemistry 2023Quote: ... Eluted fractions were analyzed using sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE; Figure S1) gels run under denaturing conditions using SurePAGE Bis-Tris gels (GenScript) and MES-SDS running buffer (GenScript ...
-
bioRxiv - Biochemistry 2023Quote: ... followed by staining using the eStain L1 Protein Staining System (GenScript). PAGE-MASTER Protein Standard Plus (GenScript ...