Labshake search
Citations for GenScript :
1451 - 1500 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: A bacterial codon-optimized human MITF-M+ ORF synthesized by GenScript Biotech was cloned using Gibson assembly (New England Biolabs ...
-
bioRxiv - Molecular Biology 2023Quote: The following commercial antibodies were used: FLAG (A00187, GenScript, mouse, 1:1000); HA (11867423001 ...
-
bioRxiv - Molecular Biology 2023Quote: ... cDNAs coding for NSP8 and NSP7 proteins were codon-optimised and custom-synthesised with an N-terminal 6X-His tag in the pET28a vector (Figure S1, GenScript, USA). The NSP12 ...
-
bioRxiv - Synthetic Biology 2023Quote: ... The cDNA of pMag, pbF, and Dkk1c (the C-terminal domain of human Dkk1, residues 177-266) were synthesized by Genscript. The plasmid constructs pMag-pbF and RRP-Dkk1c ...
-
bioRxiv - Plant Biology 2023Quote: ... anti-beta Actin [HRP] (GenScript), anti-DspE50 ...
-
bioRxiv - Physiology 2023Quote: ... mScarlet-tagged versions of these plasmids were generated by GenScript, replacing the sequence encoding dsRed with sequence encoding mScarlet(52) ...
-
bioRxiv - Microbiology 2023Quote: ... was detected by HRP-conjugated rabbit anti-camelid VHH antibodies (Genscript, A01861-200, 1/5000) or a mouse anti-HA antibody (BioLegend 901501 ...
-
bioRxiv - Microbiology 2023Quote: ... Amplified DNA was used for PacBio sequencing using a commercial protocol (Genscript). We obtained 373,772 subreads with an N50 (type of median length of the reads ...
-
bioRxiv - Microbiology 2023Quote: ... coli lysate (Genscript, USA). The diluted serum samples were incubated with the protein arrays overnight at 40C ...
-
bioRxiv - Genomics 2023Quote: ... It consists of a gene synthesized by Genscript of CHO codon-optimized sequence of RhGB07 ...
-
bioRxiv - Developmental Biology 2023Quote: ... Mouse Meis2 isoform D (4) (the tag was removed) and Lhx6 variant 1 (C-DYK) expressing vectors were purchased from Genscript, Dlx5 and Pbx1 coding sequences were amplified from mouse cDNA and cloned into pcDNA3.1 (Genscript) ...
-
bioRxiv - Developmental Biology 2023Quote: ... Dlx5 and Pbx1 coding sequences were amplified from mouse cDNA and cloned into pcDNA3.1 (Genscript). Meis2 vector was mutated with NEBuilder HiFi DNA Assembly kit (NEB ...
-
bioRxiv - Genomics 2023Quote: ... little brown bat (19-629) and greater horseshoe bat (19-615) ACE2 genes were synthesized by Genscript and cloned in after the human pregnancy specific glycoprotein 1 signal peptide and is followed by a 3C protease cleavage site ...
-
bioRxiv - Cell Biology 2023Quote: ... accession number XM_006514830.3) and type 3 (transcript variant 1, accession number NM_001363282.1) was purchased from GenScript (Clone IDs OMu45282 and OMu45285 ...
-
bioRxiv - Molecular Biology 2023Quote: Extant and reconstructed cDNA encoding MDM2 variants were purchased from GenScript in either a pSY10 plasmid resulting in a construct with an N-terminal NusA domain followed by a TEV protease site ...
-
bioRxiv - Cell Biology 2023Quote: ... GFP-XK was obtained from Genscript. GFP-Sec61β was a gift from T ...
-
bioRxiv - Plant Biology 2023Quote: The constructs CMV::ACD6Col-0 and CMV::MHA1L were synthesized in pcDNA3.1 myc-6xHis or pcDNA3.1 mGFP5-6xHis (GenScript Biotech, NJ, USA). Two codon-optimized ACD6Col-0 sequences were obtained and synthesized from gBlock synthesis (GenScript ...
-
bioRxiv - Microbiology 2023Quote: ... Full-length and C-terminal constructs were purified by Ni-IDA affinity chromatography (GenScript) as per the manufacturer’s instructions ...
-
bioRxiv - Evolutionary Biology 2023Quote: The A47L homology donor was synthesized and cloned into pUC19 (Genscript). The C1L homology donor was generated by PCR using VC2 DNA as a template and sequential restriction digest-based cloning for the 3’ and 5’ homology arms ...
-
bioRxiv - Biophysics 2023Quote: ... The anti-Scm3 antibodies were generated in rabbits against a recombinant Scm3 protein fragment (residues 1-28) of the protein by Genscript. The company provided affinity-purified antibodies that we validated by immunoprecipitating Scm3 from yeast strains with Scm3-V5 and confirming that the antibody recognized a protein of the correct molecular weight that was also recognized by α-V5 antibody (Invitrogen ...
-
bioRxiv - Bioengineering 2023Quote: ... Cells were subsequently washed with PBS and stained with α-camelid VHH antibodies (1:100, clone 96A3F5, Genscript) in 200 µl Cell Staining buffer for 30 min at 4 °C ...
-
bioRxiv - Molecular Biology 2023Quote: ... Inhibitory ExbD-based cyclic peptides were purchased from GenScript USA ...
-
bioRxiv - Cell Biology 2023Quote: ... The mixture of extracted proteins and loading buffer (Beyotime, Catalog#P0015B) was denatured at 95℃ for 10 minutes and added to the prefabricated PAGE gels (GenScript, Nanjing, China). Separated proteins were then electroblotted onto polyvinylidene difluoride (PVDF ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... synthesized and cloned into pcDNA3.4(+) vector by Genscript synthesis services ...
-
bioRxiv - Immunology 2023Quote: ... and purchased from Genscript. The specified M2e peptide library was coated in the 96-well plates (Corning ...
-
bioRxiv - Genetics 2023Quote: The expression vector for C-terminally Flag-tagged full-length human GDF15 was obtained from Genscript. The C211G mutant was generated by site-directed mutagenesis of the wild-type vector using the QuikChange II protocol (Agilent) ...
-
bioRxiv - Molecular Biology 2023Quote: ... cDNAs encoding WT and mutant IVDs were synthesized (GenScript or TWIST Bioscience) or generated via PCR (Supplemental Table 1) ...
-
bioRxiv - Microbiology 2023Quote: ... Electrophoresed material was transferred to nitrocellulose membranes and blots were developed with primary antibodies against the Strep-tag (Genscript) or RNA polymerase (RNAP ...
-
bioRxiv - Microbiology 2023Quote: ... Gibson assembly or by direct synthesis from GenScript. Mutations in plasmids were introduced through Site-directed mutagenesis ...
-
bioRxiv - Microbiology 2023Quote: Genes were codon-optimized and synthesized by Genscript (Piscataway, USA) or Integrated DNA Technologies (Coralville ...
-
bioRxiv - Immunology 2023Quote: ... cloning and mutagenesis was performed by GenScript (USA).
-
bioRxiv - Microbiology 2023Quote: ... A codon optimized form of lpxE from Francisella novicida was synthesized by GenScript and cloned into pUC57 yielding pUC57::lpxE ...
-
bioRxiv - Immunology 2023Quote: ... Constructs were synthesized and cloned (Genscript) into a custom pLVX-EF1a-P2A-GFP-IRES-Puro lentiviral vector ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-Akr1B-2 at 1:100,000 (produced to full-length Drosophila p23 (Q9VH95) by GenScript) and mouse anti-α-Tubulin at 1:5000 (AB_477593 ...
-
bioRxiv - Cell Biology 2023Quote: ... DCP-Bio1-bound proteins were pulled down with Streptavidin-coated magnetic beads (Genscript #L00936) overnight at 4 °C following manufacturer’s protocol ...
-
bioRxiv - Immunology 2023Quote: ... a biotinylated rat polyclonal antibody against human Fc was used as a capture antibody and anti-human IgG Fc-HRP (GenScript Cat# A01854-200) as a detection antibody ...
-
bioRxiv - Cell Biology 2023Quote: Recombinant proteins and Ov-ES products were evaluated for the presence of lipopolysaccharide (LPS) using a chromogenic LAL endotoxin assay kit (GenScript, Piscataway, NJ, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Plant Biology 2023Quote: ... and 1 μM flg22 (RP19986; GenScript, Nanjing, China) or 1 µM RPH1 or 1 µM GFP proteins ...
-
bioRxiv - Neuroscience 2023Quote: ... DMSO or Aβ40 (ApexBio and Genscript) was applied at the same time as LPS ...
-
bioRxiv - Microbiology 2023Quote: ... berghei TRAP was developed by GenScript Inc. ...
-
bioRxiv - Neuroscience 2023Quote: ... or tat-scrambled (YGRKKRRQRRRGGVGNDFFINHETTGFATEW) (7.5 µg, Genscript) dissolved in 5 µL PBS ...
-
bioRxiv - Cell Biology 2023Quote: ... Cells were transfected with the recombinant plasmid carrying the human TDP1 gene (GenScript, OHU22350D) using PEI transfection reagent as previously described (Popovic et al. ...
-
bioRxiv - Microbiology 2023Quote: ... or rabbit anti-protein C (1:3000, GenScript) as primary antibodies ...
-
bioRxiv - Systems Biology 2023Quote: ... Synthesis of DNA and custom cloning was performed by Genscript.
-
bioRxiv - Developmental Biology 2023Quote: ... the plexA sgRNA sequences CATTACTTCAGTACCGGTGG and GTTGACGCTTGTACACATGA were made by gene synthesis in pUC57 (GenScript) and cloned into pCFD4 (Port et al. ...
-
bioRxiv - Developmental Biology 2023Quote: ... the sema sgRNA sequences ACTTTCCTTATTGTTTTTTC and TGTGTTCTAACGGTAAGTAT were made by gene synthesis in pUC57 (GenScript) then cloned into pCFD4 (Port et al. ...
-
Structural insight into guanylyl cyclase receptor hijacking of the kinase–Hsp90 regulatory mechanismbioRxiv - Biochemistry 2023Quote: ... The protein complex was eluted with the addition of 200 μg/mL of FLAG peptide (DYKDDDD) (GenScript). Protein was subsequently concentrated to >2 mg/mL and used for cryo-EM imaging.
-
bioRxiv - Biochemistry 2023Quote: ... or proteins were transferred to PVDF membranes using an eBlot L1 protein transfer system (GenScript, Piscataway, NJ) and used for immunoblotting.
-
bioRxiv - Immunology 2023Quote: ... mice were intraperitoneally immunized with 250μg gp61 (GLKGPDIYKGVYQFKSVEFDC) peptide conjugated to OVA (GenScript) mixed with 50% (v/v ...
-
bioRxiv - Genetics 2023Quote: ... Identified homozygous PC-9_ EGFRdel19-ARTi clones were further engineered by cutting endogenous EGFR with a CRISPR all-in-one vector pX458_Exon20_gRNA TAGTCCAGGAGGCAGCCGAA (GenScript) using X-tremeGENE 9 DNA transfection reagent (Roche ...