Labshake search
Citations for Takara Bio :
1 - 50 of 809 citations for Anti 6 His SAP since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2019Quote: ... Western blotting was performed with anti-6×His mouse mAb (Clontech), with secondary IRDye 800CW goat anti-mouse (LI-COR ...
-
bioRxiv - Molecular Biology 2021Quote: ... transferred onto nitrocellulose and detected with either mouse anti-6×His (Clontech) at 0.25 µg/ml or rabbit antibody against calmodulin binding peptide Calmodulin Binding Peptide (GenScript ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-His (Clontech 631212), anti-H3K36me2 (Upstate 07-369) ...
-
bioRxiv - Synthetic Biology 2022Quote: ... After digestion by BamHI and dephosphorylation treatment using SAP (TaKaRa), the DNA fragment was ligated with 1.5-2.5 kbp fragments of the Sau3AI-digested S ...
-
bioRxiv - Microbiology 2023Quote: ... embedding and immunogold staining using a 6×His monoclonal antibody (Takara Bio) diluted 1/5000 as the primary antibody ...
-
bioRxiv - Microbiology 2021Quote: ... His-Raf1, His-ATG8) and empty plasmids (GST tag, 6×His tag) were transformed into component cells Escherichia coli BL21 (Takara, 9126) or BL21 (DE3 ...
-
bioRxiv - Cell Biology 2023Quote: Hexa-Histidine (6×His)-tagged bacterial expression constructs were created using pColdI (Takara) vector backbone ...
-
bioRxiv - Microbiology 2022Quote: ... Western blots using Anti-His primary antibody (Clontech) (1:4000 dilution ...
-
bioRxiv - Neuroscience 2020Quote: ... CyRFP excised with NheI and NotI from pCAG-CyRFP was blunted with SAP (Takara: 2660A) and Klenow (Takara ...
-
bioRxiv - Molecular Biology 2023Quote: ... His (Clontech), supplemented with 1.5 mM 3-amino-1,2,4-triazol (3-AT ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Samples containing the thereby secreted [His]6-tagged VHH-HlyA fusions were next passed through Talon CellThru resin (Clontech). For this ...
-
bioRxiv - Developmental Biology 2021Quote: ... –His (630428, Clontech) or –Trp ...
-
bioRxiv - Developmental Biology 2021Quote: ... –His (630419, Clontech) selective media +3 mM ...
-
bioRxiv - Plant Biology 2022Quote: ... and His (Clontech) with and without the addition of 3-Amino-1H-1,2,4-triazole (Acros Organics (Thermo Fisher Scientific) ...
-
bioRxiv - Plant Biology 2022Quote: ... Purification of His-tagged proteins was carried out using His-tag affinity resin (His-resin) (Clontech, CA, USA).
-
bioRxiv - Neuroscience 2021Quote: ... Clover-(His)6-LactC2 was purified from the supernatant with 3mL of the TALON superflow metal affinity resin (Clontech, CA). The resin was washed with 5 mM imidazole in PBS ...
-
bioRxiv - Microbiology 2023Quote: ... His-tagged mCherry (mCherry-His) was PCR amplified from pmCherry-C1 vector (Takara) templates with primers encoding a His-tag and NcoI/NotI cut sites (Takara) ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Developmental Biology 2023Quote: ... Interactions were evaluated on agar that was -His or -His -Ade (Clontech, now Takara Bio). Growth in the absence of either supplement indicates transcription from reconstituted GAL4 proteins ...
-
bioRxiv - Developmental Biology 2023Quote: ... Interactions were evaluated on agar that was -His or -His -Ade (Clontech, now Takara Bio). Growth in the absence of either supplement indicates transcription from reconstituted GAL4 proteins ...
-
bioRxiv - Immunology 2023Quote: ... The 6-His tagged recombinant proteins were purified from the supernatant by gravity-fed through TALON® Metal Affinity Resin (Takara Bio, Shiga, Japan). Following a wash step with PBS (pH 8) ...
-
bioRxiv - Microbiology 2020Quote: ... CloneAmp Hi-Fi PCR Premix (Takara) and the following PCR conditions were used to generate the amplicons ...
-
bioRxiv - Cell Biology 2021Quote: α-His primary antibody (1/10,000; Clontech) and HRP-conjugated goat anti-mouse IgG (H+L ...
-
bioRxiv - Cell Biology 2020Quote: ... His (Takara/Clontech 631212, 1:1000), GFP (Roche 11814460001 ...
-
bioRxiv - Cell Biology 2020Quote: ... His (Takara/Clontech 631212, 1:1000), GFP (Roche 11814460001 ...
-
bioRxiv - Bioengineering 2019Quote: ... MO). The horseradish peroxidase (HRP)-conjugated monoclonal anti-His antibody (anti-mouse Cat. #631210) was obtained from Clontech (Mountain View, CA). The ultrasensitive HRP substrate used for Western blotting was from TaKaRa (Shiga ...
-
bioRxiv - Molecular Biology 2020Quote: ... Fractions were precipitated with trichloroacetic acid (TCA) and subjected to Western blot analysis (anti-His antibody, Clontech). Additionally ...
-
bioRxiv - Bioengineering 2019Quote: ... SD-His or SD-Trp-Ura (Clontech). Mycoplasma pneumoniae strain M129 (ATCC 29342) ...
-
bioRxiv - Microbiology 2019Quote: ... and loaded on His 60 Ni resin (TAKARA) after equilibrating ...
-
bioRxiv - Plant Biology 2021Quote: ... whereas selective media additionally lacked His (−4) (Clontech).
-
bioRxiv - Molecular Biology 2019Quote: ... Clarified lysates were incubated with HIS-60 (Takara) resin for 30-60 minutes ...
-
bioRxiv - Molecular Biology 2020Quote: ... Samples were analyzed on bleach agarose gels (0.06% bleach, 1% (w/v) agarose) for visualization of the RNA and on WB (anti-His antibody, Clontech) for visualization of His6-tagged Nsp1.
-
bioRxiv - Plant Biology 2020Quote: ... 3-μL aliquots of each dilution were used to inoculate SD/−Trp/−His/−Ade medium and SD/−Trp/−His medium with X-α-Gal (Clontech). The inoculated media were incubated for 4 days at 30 °C ...
-
bioRxiv - Plant Biology 2022Quote: ... His (SD/-Trp/-Leu/-Ade/-His) and with sprayed 100 µl of 4 mg/ml X-α-Gal (Takara Bio, CA, USA) in dimethylformamide on plates (SD/-Trp/-Leu/-His/X-α-Gal) ...
-
bioRxiv - Biochemistry 2023Quote: ... Expression plasmids for other His-mCherry or His-GFP fusion proteins were constructed using in-Fusion HD Cloning Kit (Takara Bio, Inc.). All mCherry/GFP fusion proteins were expressed in E ...
-
bioRxiv - Molecular Biology 2021Quote: ... Beads were washed twice with Pulldown Buffer and ran on SDS-PAGE followed by western blotting (anti-His Clontech 631212).
-
bioRxiv - Plant Biology 2023Quote: ... and the input and pull-down prey proteins were detected by immunoblot using anti-His (M201, Takara, 1:3000 dilution) and anti-GST (G018 ...
-
bioRxiv - Plant Biology 2020Quote: ... Ade and His but containing X-α-gal (Clontech) and 10 mM 3-amino-1,2,4-triazole (3-AT) ...
-
bioRxiv - Biochemistry 2019Quote: ... a 96-well Capturem His-tagged purification kit (Clontech) was used according to the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2020Quote: ... and –His/–Trp/–Ura dropout supplement (Clontech, cat. 630424). Colonies were grown in SD/–His/–Trp/–Ura medium for one night at 30 °C ...
-
bioRxiv - Synthetic Biology 2023Quote: ... SD-Trp-Ura or SD-His-Leu (Clontech Takara).
-
bioRxiv - Synthetic Biology 2023Quote: ... SD-Trp-Ura or SD-His-Leu (Clontech Takara).
-
bioRxiv - Neuroscience 2023Quote: ... SMARTer Stranded Total Sample prep kit-HI Mammalian (Takara, 634875) was used to generate libraries for RNA sequencing.
-
bioRxiv - Molecular Biology 2022Quote: ... downstream of the His tag with In-Fusion HD (TaKaRa). The Gly172Phe substitution was induced by site-directed mutagenesis.
-
bioRxiv - Molecular Biology 2022Quote: ... downstream of the His tag with In-Fusion HD (TaKaRa). The His154Gly substitution was induced by site-directed mutagenesis.
-
bioRxiv - Biochemistry 2023Quote: ... Cleavage of the His-tag by HRV3C protease (Takara, 7360) followed the manufacturer’s protocol ...
-
bioRxiv - Immunology 2024Quote: ... His-tagged CD45RO was purified by TALON affinity resin (Takara) according to the manufacturer’s instructions ...
-
bioRxiv - Genetics 2022Quote: ... then washed in water and re-suspended in 125-250mL -leu - his galactose liquid culture (Takara Bio Minimal SD Bases, Takara Bio DO Supplement -His/-Leu). Cultures were grown to saturation ...
-
bioRxiv - Neuroscience 2021Quote: ... His-tagged Cbln1 were purified by Talon metal affinity resin (Clontech) and dialyzed against HBSS ...
-
bioRxiv - Molecular Biology 2020Quote: ... The supernatant was incubated with TALON His-tag purification resin (TaKaRa) or glutathione agarose beads (Sigma-Aldrich ...