Labshake search
Citations for Eurogentec :
1 - 50 of 126 citations for Trans 4 Hydroxy L Proline Rabbit Polyclonal Conjugated since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2019Quote: ... Polyclonal rabbit antisera were obtained from Eurogentec (Seraing, B), raised against the N-terminal GPT sequences (91 amino acids of GPT1 or 92 amino acids of GPT2 ...
-
bioRxiv - Plant Biology 2019Quote: ... and used to raise polyclonal antibody in rabbits (Eurogentec). From the crude immunserum specific IgG fraction was isolated as described above.
-
bioRxiv - Cell Biology 2020Quote: ... N2A polyclonal anti-rabbit (custom-made by Eurogentec, Seraing, Belgium), PEVK polyclonal anti-rabbit (Myomedix ...
-
bioRxiv - Cell Biology 2020Quote: Anti-TMEM70 antibodies were rabbit polyclonal sera raised by Eurogentec SA (Belgium ...
-
bioRxiv - Biochemistry 2023Quote: Polyclonal rabbit antiserum against TbPam16 was commercially produced (Eurogentec, Belgium) using amino acids 153-167 (VKDSHGNSRGNDAMW ...
-
bioRxiv - Microbiology 2019Quote: Polyclonal rabbit anti-Pkn14 antibodies were generated by Eurogentec (Serain, Belgium) using soluble purified Strep-Pkn14 protein ...
-
bioRxiv - Cell Biology 2021Quote: 2Y4824 rabbit polyclonal antibody (pAb) anti-LPHN2 was produced by Eurogentec by immunizing animals with peptide GGKTDIDLAVDENGL (amino acids 259-274 ...
-
bioRxiv - Neuroscience 2020Quote: ... Polyclonal antibodies targeting Ush2A were generated in the rabbit by Eurogentec® (Liege ...
-
bioRxiv - Cell Biology 2021Quote: NCAPH2: Rabbit polyclonal produced on demand by Eurogentec (WB:1/1000).
-
bioRxiv - Microbiology 2022Quote: Polyclonal IgGs were developed in New Zealand White Rabbits (Eurogentec, Belgium) as per the company’s protocol ...
-
bioRxiv - Microbiology 2019Quote: ... All polyclonal antibodies were purified from pooled sera of two immunized rabbits (Eurogentec).
-
bioRxiv - Biochemistry 2021Quote: ... The polyclonal TbUbL1 rabbit antisera used for immunoblots was produced commercially by Eurogentec using peptide sequence CSEISGNHRSSEHNAG ...
-
bioRxiv - Molecular Biology 2023Quote: The rabbit polyclonal anti-BmVreteno antibody was generated by immunizing rabbits with the affinity purified BmVreteno (186-381) antigen (Eurogentec). 2 mL sulfolink resin (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2020Quote: ... LecA was detected by a custom-made polyclonal rabbit anti-LecA antibody (Eurogentec, France).
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa40-59 JCPyV agno-sera (generated on request by Eurogentec, Belgium), polyconal anti-BKPyV agnosera (generous gift from C ...
-
bioRxiv - Plant Biology 2020Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa40-53 BKPyV agno-sera (generated on request by Eurogentec, clone 1163), polyclonal rabbit anti-BKPyV LTag sera (generous gift from C ...
-
bioRxiv - Plant Biology 2022Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Biochemistry 2024Quote: The expression and cellular localization of BT4244 M60L was determined using rabbit polyclonal antibodies (Eurogentec) generated against a purified recombinant version of the protein lacking the lipoprotein signal sequence ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa52-66 BKPyV agno-sera (generated on request by Eurogentec, Belgium, clone 753), polyclonal rabbit anti-aa40-53 BKPyV agno-sera (generated on request by Eurogentec ...
-
bioRxiv - Cell Biology 2021Quote: The polyclonal rabbit phospho-ACBD5 Ser269 antibody (α-ACBD5 pS269) was produced by Eurogentec (Seraing, Belgium). The antibody was raised against peptide 264EVYCDSMEQFGQE276 including a phospho-Ser269 ...
-
bioRxiv - Cell Biology 2023Quote: Purified recombinant TbSmee1(1-400) was used for the generation of two polyclonal rabbit antisera (Eurogentec). Antisera (303 ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Cell Biology 2021Quote: ... were digested with Prescission protease (Amersham Pharmacia Biotech) and used to produce monoclonal antibodies as described42 and to raise polyclonal rabbit antiserum #4457 (Eurogentec). The NHSL1 monoclonal antibody was subcloned twice (clone C286F5E1 ...
-
bioRxiv - Microbiology 2023Quote: ... Protein samples were analyzed by SDS-PAGE to determine purity prior to their use for immunization in rabbits for the generation of an affinity purified polyclonal antibody (Eurogentec).
-
bioRxiv - Microbiology 2023Quote: ... recombinantly produced EF-P was purified and sent to Eurogentec for polyclonal antibody generation (Speedy 28-day program in rabbits, Eurogentec). The blood serum containing antibodies against the R ...
-
bioRxiv - Developmental Biology 2020Quote: DILP2 peptide corresponding to the sequence TRQRQGIVERC (amino acids 108-118) was used as an immunogen to raise DILP2 polyclonal antibody in rabbit (Eurogentec, Belgium). Mouse anti-GFP (Cat ...
-
bioRxiv - Plant Biology 2021Quote: A solution containing 3.5 mg of purified recombinant LbGH28A protein was used to elicit the production of polyclonal antibodies in rabbit according to the manufacturer’s procedure (Eurogentec, Seraing, Belgium). The indirect immunofluorescent (IIF ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Microbiology 2022Quote: ... The proteins were injected into rabbits to generate polyclonal antibodies according to standard protocols (His-GspD, Cocalico, Reamstown, PA; His-PilQOlut, Eurogentec, Seraing, BE). Sera were tested for cross-reactivity by immunoblotting lysates from wildtype M ...
-
bioRxiv - Neuroscience 2023Quote: ... The synthetic peptide was conjugated to keyhole limpet hemocyanin for immunization of rabbits and guinea pigs (Eurogentec, Belgium). Resulting sera were affinity-purified on the peptide antigen and the specificity of the resulting antibodies was confirmed using lysates and tissue sections from Rbm20 knock-out mice.
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Cell Biology 2023Quote: Crb3 homeolog L and S specific antibodies were obtained by immunizing rabbits using the speedy protocol from Eurogentec (Seraing, Belgium). The synthetic peptides identical to the ectodomain of Crb3.L (H-QNVTTSAPDRLSESAR-C ...
-
bioRxiv - Microbiology 2019Quote: ... Polyclonal Anti-Rv3852 antibody was produced by Eurogentec (30).
-
bioRxiv - Plant Biology 2019Quote: ... All the polyclonal antisera were affinity purified by Eurogentec. The immunodetection was performed with a chemiluminescent detection system kit (Pierce™ ECL Western Blotting Substrate ...
-
bioRxiv - Cell Biology 2021Quote: ... Polyclonal antibodies were raised against the fusion protein (Eurogentec). Immuno-reactive complexes were detected using horseradish-peroxidase coupled anti-rabbit or anti-mouse antibodies (Sigma-Aldrich/Merck ...
-
bioRxiv - Molecular Biology 2019Quote: ... Pab-DnaG or Pab-aCPSF1 (custom polyclonal antibodies, Eurogentec) diluted 10,000-fold and an anti-rabbit IgG HRP conjugate (Promega ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal anti Am TIG1 antibodies were manufactured by Eurogentec, by raising rabbit antisera against two non-overlapping peptides corresponding to residues MAQVKSVKQRLRND (154 ...
-
bioRxiv - Microbiology 2021Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody using an ImageQuant LAS 4000 mini digital imaging system (GE Healthcare) ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti- rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... DnaD and FtsZ were probed with polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Proteins were probed via α-DnaD polyclonal primary antibodies (Eurogentec) and then detected with an anti-rabbit horseradish peroxidase-linked secondary antibody (A6154 ...
-
bioRxiv - Developmental Biology 2022Quote: ... Purified protein was shipped for antibody production (custom polyclonal antibodies, Eurogentec). Rabbit polyclonal anti-Shp1 was purified in house by affinity purification ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Cell Biology 2023Quote: A custom polyclonal antibody to RAB18 generated by Eurogentec (Southampton, UK) has been described previously (10) ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-NPH3 purified polyclonal antibodies raised against peptides IPNRKTLIEATPQSF and GVDHPPPRKPRRWRN (Eurogentec) and polyclonal antibodies raised against phosphorylated S744 of NPH3 using peptide KPRRWRNpSIS (where pS represents phosphorylated serine ...
-
bioRxiv - Microbiology 2020Quote: ... and those with Hcp pooled and used to generate polyclonal antibodies (EuroGentec).
-
bioRxiv - Cell Biology 2023Quote: ... A third polyclonal antibody (508) was generated against two TbSmee1 peptides (Eurogentec) and affinity purified using the peptide antigens immobilised on a Sulfolink affinity column (ThermoFisher) ...
-
bioRxiv - Molecular Biology 2019Quote: ... a polyclonal exWAGO antibody was used (generated and purified against peptides TKQTKDDFPEQERK, Eurogentec) overnight at 4°C ...
-
bioRxiv - Developmental Biology 2024Quote: Polyclonal antibodies against Spar (CG4577) were custom generated in guinea pigs by Eurogentec. Two Spar peptides corresponding to epitopes LQEIDDYVPERRVSS (amino acids 212-226 ...