Labshake search
Citations for Eurogentec :
1 - 50 of 192 citations for NK 1 Receptor Rabbit Polyclonal affinity purified biotin labeled since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2019Quote: ... All the polyclonal antisera were affinity purified by Eurogentec. The immunodetection was performed with a chemiluminescent detection system kit (Pierce™ ECL Western Blotting Substrate ...
-
bioRxiv - Molecular Biology 2023Quote: The rabbit polyclonal anti-BmVreteno antibody was generated by immunizing rabbits with the affinity purified BmVreteno (186-381) antigen (Eurogentec). 2 mL sulfolink resin (Thermo Fisher Scientific ...
-
bioRxiv - Microbiology 2023Quote: ... Protein samples were analyzed by SDS-PAGE to determine purity prior to their use for immunization in rabbits for the generation of an affinity purified polyclonal antibody (Eurogentec).
-
bioRxiv - Cell Biology 2023Quote: Purified recombinant TbSmee1(1-400) was used for the generation of two polyclonal rabbit antisera (Eurogentec). Antisera (303 ...
-
bioRxiv - Microbiology 2019Quote: ... All polyclonal antibodies were purified from pooled sera of two immunized rabbits (Eurogentec).
-
bioRxiv - Plant Biology 2020Quote: ... 2013) were used to immunize rabbits and antisera were purified by affinity chromatography with the corresponding protein (Eurogentec).
-
bioRxiv - Microbiology 2023Quote: ... and subsequently affinity-purified against GST-YgfB protein (Eurogentec).
-
bioRxiv - Microbiology 2020Quote: ... The antibody’s affinity (Eurogentec; Peptide: 1911009, Rabbit 237) was confirmed through ELISA.
-
bioRxiv - Cell Biology 2021Quote: NCAPH2: Rabbit polyclonal produced on demand by Eurogentec (WB:1/1000).
-
bioRxiv - Biochemistry 2021Quote: ... The antibody was affinity purified against the antigen by Eurogentec, and used at a 1:50 dilution ...
-
bioRxiv - Genomics 2023Quote: ... The anti-RpHEI10 was a combination of two antibodies raised in rabbits against the peptides CNRPNQSRARTNMFQL and CPVRQRNNKSMVSGGP (gene ID: RP3G01271190/RP3G01008630/RP1G00269340/RP2G00699130) and affinity-purified (Eurogentec). Each primary antibody was diluted 1:200 in blocking solution ...
-
bioRxiv - Genomics 2023Quote: ... The anti-RpREC8 was a combination of two antibodies raised in rabbits against the peptides CEEPYGEIQISKGPNM and CYNPDDSVERMRDDPG (gene ID: RP1G00316120/RP2G00915110/RP4G01319620/RP5G01638170) and affinity-purified (Eurogentec). The anti-RpHEI10 was a combination of two antibodies raised in rabbits against the peptides CNRPNQSRARTNMFQL and CPVRQRNNKSMVSGGP (gene ID ...
-
bioRxiv - Molecular Biology 2023Quote: ... The anti-AGO1-N-coil antibody was affinity purified by Eurogentec from sera collected from a rabbit immunized with a 16-amino acid peptide from the N-coil of AGO1 (F177-C192 ...
-
bioRxiv - Microbiology 2023Quote: ... recombinantly produced EF-P was purified and sent to Eurogentec for polyclonal antibody generation (Speedy 28-day program in rabbits, Eurogentec). The blood serum containing antibodies against the R ...
-
bioRxiv - Plant Biology 2019Quote: ... Polyclonal rabbit antisera were obtained from Eurogentec (Seraing, B), raised against the N-terminal GPT sequences (91 amino acids of GPT1 or 92 amino acids of GPT2 ...
-
bioRxiv - Plant Biology 2019Quote: ... and used to raise polyclonal antibody in rabbits (Eurogentec). From the crude immunserum specific IgG fraction was isolated as described above.
-
bioRxiv - Developmental Biology 2022Quote: ... Purified protein was shipped for antibody production (custom polyclonal antibodies, Eurogentec). Rabbit polyclonal anti-Shp1 was purified in house by affinity purification ...
-
bioRxiv - Plant Biology 2020Quote: ... synthetic peptides (Fig. S9) were used for rabbit immunization and affinity chromatography (Eurogentec). For assessing the specificity and cross-reaction of the antibodies ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A polyclonal anti-rabbit (custom-made by Eurogentec, Seraing, Belgium), PEVK polyclonal anti-rabbit (Myomedix ...
-
bioRxiv - Cell Biology 2020Quote: Anti-TMEM70 antibodies were rabbit polyclonal sera raised by Eurogentec SA (Belgium ...
-
bioRxiv - Biochemistry 2023Quote: Polyclonal rabbit antiserum against TbPam16 was commercially produced (Eurogentec, Belgium) using amino acids 153-167 (VKDSHGNSRGNDAMW ...
-
bioRxiv - Plant Biology 2021Quote: ... anti-NPH3 purified polyclonal antibodies raised against peptides IPNRKTLIEATPQSF and GVDHPPPRKPRRWRN (Eurogentec) and polyclonal antibodies raised against phosphorylated S744 of NPH3 using peptide KPRRWRNpSIS (where pS represents phosphorylated serine ...
-
bioRxiv - Cell Biology 2020Quote: ... Polyclonal rabbit antisera to Abi-1 (1:2000 dilution) and ArpC1 (p40, 1:500 dilution) were raised (by Eurogentec Deutschland GmbH, Köln, Germany) against the synthetic peptides PPVDYEDEEAAVVQYNDPYADGDPAWAPKNYI derived from the human Abi-1 sequence and TARERFQNLDKKASSEGGTAAG derived from the human ArpC1B sequence ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified GST tagged TMEM184B peptides TMEM184B 1-67 and TMEM184B 393-486 in equal proportions (1:1) were injected into rabbits using the Eurogentec Polyclonal Antibody Production service (Eurogentec, Belgium) using an 87 day protocol ...
-
bioRxiv - Molecular Biology 2019Quote: ... a polyclonal exWAGO antibody was used (generated and purified against peptides TKQTKDDFPEQERK, Eurogentec) overnight at 4°C ...
-
bioRxiv - Microbiology 2019Quote: Polyclonal rabbit anti-Pkn14 antibodies were generated by Eurogentec (Serain, Belgium) using soluble purified Strep-Pkn14 protein ...
-
bioRxiv - Cell Biology 2021Quote: 2Y4824 rabbit polyclonal antibody (pAb) anti-LPHN2 was produced by Eurogentec by immunizing animals with peptide GGKTDIDLAVDENGL (amino acids 259-274 ...
-
bioRxiv - Neuroscience 2020Quote: ... Polyclonal antibodies targeting Ush2A were generated in the rabbit by Eurogentec® (Liege ...
-
bioRxiv - Microbiology 2022Quote: Polyclonal IgGs were developed in New Zealand White Rabbits (Eurogentec, Belgium) as per the company’s protocol ...
-
bioRxiv - Microbiology 2023Quote: ... 100 μl/well polyclonal rabbit antiserum against p24 antigen (Eurogentec, 1:1,000 in PBS-T with 10% (v/v) FCS ...
-
bioRxiv - Neuroscience 2024Quote: ... capture and detection antibody was the same affinity-purified custom anti-(GP)8 antibody (Eurogentec, biotinylated for detector). For polyGA ...
-
bioRxiv - Biochemistry 2021Quote: ... The polyclonal TbUbL1 rabbit antisera used for immunoblots was produced commercially by Eurogentec using peptide sequence CSEISGNHRSSEHNAG ...
-
bioRxiv - Cell Biology 2020Quote: ... LecA was detected by a custom-made polyclonal rabbit anti-LecA antibody (Eurogentec, France).
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa40-59 JCPyV agno-sera (generated on request by Eurogentec, Belgium), polyconal anti-BKPyV agnosera (generous gift from C ...
-
bioRxiv - Genomics 2023Quote: ... The anti-ZYP1 was raised in chickens against the peptide EGSLNPYADDPYAFD of the C-terminal end of AtZYP1a/b (gene ID: At1g22260/At1g22275) and affinity-purified (Eurogentec) (PAK048) ...
-
bioRxiv - Cell Biology 2022Quote: ... purified via nickel columns and used to immunize rabbits (Eurogentec). The polyclonal rabbit antiserum against ATOM40 (IB 1:10’000 ...
-
bioRxiv - Plant Biology 2020Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa40-53 BKPyV agno-sera (generated on request by Eurogentec, clone 1163), polyclonal rabbit anti-BKPyV LTag sera (generous gift from C ...
-
bioRxiv - Plant Biology 2022Quote: ... the membrane was incubated with a rabbit polyclonal antiserum raised against recombinant ATC (Eurogentec, Belgium) for 1 h ...
-
bioRxiv - Biochemistry 2024Quote: The expression and cellular localization of BT4244 M60L was determined using rabbit polyclonal antibodies (Eurogentec) generated against a purified recombinant version of the protein lacking the lipoprotein signal sequence ...
-
bioRxiv - Genetics 2019Quote: ... The purified protein was used to immunize 2 rabbits (Eurogentec, Belgium), and the resulting immune antisera were tested against the recombinant antigen by ELISA (Eurogentec) ...
-
bioRxiv - Plant Biology 2021Quote: Polyclonal LPR1 epitope-specific antibodies were raised in rabbits against a mixture of two synthetic peptides (peptide I: 175-PKWTKTTLHYENKQQ-189; peptide II: 222-VESPFQLPTGDEF-234) and affinity-purified (EUROGENTEC, Seraing, Belgium). Total proteins were extracted from frozen plant material in buffer A (50 mM Tris-HCl ...
-
bioRxiv - Microbiology 2020Quote: ... polyclonal rabbit anti-aa52-66 BKPyV agno-sera (generated on request by Eurogentec, Belgium, clone 753), polyclonal rabbit anti-aa40-53 BKPyV agno-sera (generated on request by Eurogentec ...
-
bioRxiv - Cell Biology 2021Quote: The polyclonal rabbit phospho-ACBD5 Ser269 antibody (α-ACBD5 pS269) was produced by Eurogentec (Seraing, Belgium). The antibody was raised against peptide 264EVYCDSMEQFGQE276 including a phospho-Ser269 ...
-
bioRxiv - Cell Biology 2020Quote: ... N2A (polyclonal IgG, custom-made; Eurogentec, Belgium, 1:400 in PBS), and T12 (monoclonal IgG ...
-
bioRxiv - Molecular Biology 2020Quote: ... Rabbit anti-AscA antiserum was produced using purified AscA by Eurogentec (Liège, Belgium). Rabbit anti-OmpF antiserum was a kind gift from T ...
-
bioRxiv - Plant Biology 2019Quote: ... The purified recombinant protein was used to immunize rabbits by a company (Eurogentec). From the immunserum a crude IgG fraction was isolated by ammonium sulfate precipitation then IgG was further purified on protein gel blots of the antigen ...
-
bioRxiv - Neuroscience 2023Quote: ... Guinea pig anti-EAAT5b and rabbit anti-EAAT7 antibodies were column purified by Eurogentec.
-
bioRxiv - Neuroscience 2021Quote: ... anti-rabbit Six3 (1:10,000, Eurogentec custom antibody ...
-
bioRxiv - Cell Biology 2021Quote: ... were digested with Prescission protease (Amersham Pharmacia Biotech) and used to produce monoclonal antibodies as described42 and to raise polyclonal rabbit antiserum #4457 (Eurogentec). The NHSL1 monoclonal antibody was subcloned twice (clone C286F5E1 ...