Labshake search
Citations for Anaspec :
1 - 50 of 76 citations for Rat TGF beta 2 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Immunology 2023Quote: ... Total anti-MOG IgG was quantified by using SensoLyte Anti-Mouse MOG(1–125) IgG Quantitative ELISA Kit (Anaspec).
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Cell Biology 2023Quote: Analyses of MMP-2 activity were performed by a fluorescence assay kit (SensoLyte® 520 MMP-2 kit, AnaSpec, San Jose, USA). The fluorescence of the substrate cleavage product was determined at excitation/emission = 490 nm/520 nm with a Perkin-Elmer spectrofluorometer [21,22].
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Immunology 2022Quote: ... with MMP-2 (AnaSpec) and Clostridium histolyticum collagenase (ThermoFisher Scientific ...
-
bioRxiv - Immunology 2019Quote: ... (2 μg/ml/peptide, ANASPEC). Results are reported as spot-forming cells (SFC ...
-
bioRxiv - Microbiology 2019Quote: ... 2 μg/mL LL-37 (Anaspec), or 250 μg/mL kanamycin (Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by incubation overnight at 4°C with rat anti-Mer (1:1000, eBioscience, cat# 14-5751-82) and rabbit anti-P2RY12 (1:2000, AnaSpec, cat# AS-55043A) in 2% NGS and 2% NDS in PBS-T ...
-
bioRxiv - Biophysics 2021Quote: ... and magainin-2 were purchased from Anaspec (Fremont, CA). All peptides were 95% or greater purity ...
-
bioRxiv - Neuroscience 2023Quote: The synthetic peptide Adrenomedullin (ADM) (2 nmol, Anaspec, AS-60447) was incubated with either ddH20 (for control condition ...
-
bioRxiv - Biochemistry 2023Quote: ... 300 mg of 2-Cl-Trt resin purchased from Anaspec was transferred to a 10 ml Torviq disposable reaction vessel and swelled for 1 hour in dichloromethane (DCM) ...
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Neuroscience 2020Quote: ... and 2 μl of 20% Pluronic F-127 dissolved in DMSO (AnaSpec) and diluted in HBSS containing 10mg/ml BSA (Sigma) ...
-
bioRxiv - Neuroscience 2022Quote: ... cells were exposed to 2 μg/mL Fluo-488-labeled Aβ42 (Anaspec) and left to phagocytose for 2 h (37 °C ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... (GSHWAVGHLM; 50 µg/mL: 2[Ser]-NMC, produced in AnaSpec; San Jose, CA) overnight at 4°C before use ...
-
bioRxiv - Biochemistry 2021Quote: ... a HABA biotin quantification kit (AnaSpec) was used to measure the biotin concentrations of each solution ...
-
bioRxiv - Cell Biology 2021Quote: ... and Aβ-TMR (Aβ1–42-5-tetramethyl rhodamin) suspended in 1,1,1,3,3,3-hexafluoro-2-propanol (AnaSpec). Lyophilized Aβ and Aβ-TMR were resuspended at a concentration of 5 mM in Me2SO and then diluted to a concentration of 100 μM in HEPES buffer ...
-
bioRxiv - Neuroscience 2020Quote: ... rabbit anti-Rapgef2 (NNLE-2, custom-made by Anaspec, see ref. (Jiang et al., 2017). Confocal images were obtained on a Zeiss LSM 510 confocal microscope at the National Institute of Neurological Disorders and Stroke Light Imaging Facility ...
-
bioRxiv - Cell Biology 2019Quote: ... after which cells were resuspended in 2 μg/ml 7-aminoactinomycin D (7-AAD) (Anaspec). Cell viability was assessed using Gallios (Beckman Coulter ...
-
bioRxiv - Bioengineering 2023Quote: ... MMP-13 production was measured using an enzyme-specific fluorescence substrate kit (SensoLyte 520 MMP-13 Assay Kit; AnaSpec), according to the manufacturer’s instructions.
-
bioRxiv - Neuroscience 2022Quote: ... and rabbit anti-Rapgef2 (NNLE-2, custom-made by Anaspec, see ref. (Jiang et al., 2017)) ...
-
bioRxiv - Bioengineering 2023Quote: ... was determined via analysis of spent culture medium (n = 5/group/time) using a commercially available FRET-based generic MMP activity kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric; Anaspec). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Genetics 2020Quote: ... using the SensoLyte Malachite Green Assay kit (AnaSpec) in assay buffer (MgCl2 2 mmol/L ...
-
bioRxiv - Bioengineering 2024Quote: ... was determined via analysis of spent culture medium (n= 8-10/group) using a commercially available FRET-based generic MMP cleavage kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric, Anaspec, Fremont, CA). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Microbiology 2023Quote: ... Malachite green reagent (SensoLyte MG Phosphate Assay Kit [AnaSpec]) was added to each reaction and incubated for 30 min before measuring absorbance at 660 nm ...
-
bioRxiv - Immunology 2020Quote: ... before addition of 1 mL of vesiculation buffer (GPMV buffer plus 25 mM PFA (paraformaldehyde, Electron Microscopy Services) and 2 mM DTT (1,4-dithiothreitol, Anaspec). Cells were incubated for 1 hour at 37°C and GPMVs were collected by removing supernatant from cells.
-
bioRxiv - Microbiology 2020Quote: The SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec, Fremont, CA) was used according to the manufacturer’s instruction to measure the activity of the enzyme in each supernatant fraction obtained from the osmotic shock procedure (Tris/MgSO4 wash ...
-
bioRxiv - Pathology 2022Quote: MMP-12 assay kit was purchased from AnaSpec (Fremont, CA). Frozen liver tissue (50-75 mg ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Neuroscience 2023Quote: ... The SensoLyte Red Glucocerebrosidase (GBA) Activity Assay Kit (AnaSpec, AS-72259) was used to determine enzyme activity in serum and whole tissue lysate samples ...