Labshake search
Citations for Anaspec :
1 - 50 of 58 citations for Rat Salusin Beta SALb CLIA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by incubation overnight at 4°C with rat anti-Mer (1:1000, eBioscience, cat# 14-5751-82) and rabbit anti-P2RY12 (1:2000, AnaSpec, cat# AS-55043A) in 2% NGS and 2% NDS in PBS-T ...
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Biochemistry 2021Quote: ... a HABA biotin quantification kit (AnaSpec) was used to measure the biotin concentrations of each solution ...
-
bioRxiv - Bioengineering 2023Quote: ... MMP-13 production was measured using an enzyme-specific fluorescence substrate kit (SensoLyte 520 MMP-13 Assay Kit; AnaSpec), according to the manufacturer’s instructions.
-
bioRxiv - Bioengineering 2023Quote: ... was determined via analysis of spent culture medium (n = 5/group/time) using a commercially available FRET-based generic MMP activity kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric; Anaspec). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Genetics 2020Quote: ... using the SensoLyte Malachite Green Assay kit (AnaSpec) in assay buffer (MgCl2 2 mmol/L ...
-
bioRxiv - Cell Biology 2023Quote: Analyses of MMP-2 activity were performed by a fluorescence assay kit (SensoLyte® 520 MMP-2 kit, AnaSpec, San Jose, USA). The fluorescence of the substrate cleavage product was determined at excitation/emission = 490 nm/520 nm with a Perkin-Elmer spectrofluorometer [21,22].
-
bioRxiv - Bioengineering 2024Quote: ... was determined via analysis of spent culture medium (n= 8-10/group) using a commercially available FRET-based generic MMP cleavage kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric, Anaspec, Fremont, CA). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Microbiology 2023Quote: ... Malachite green reagent (SensoLyte MG Phosphate Assay Kit [AnaSpec]) was added to each reaction and incubated for 30 min before measuring absorbance at 660 nm ...
-
bioRxiv - Microbiology 2020Quote: The SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec, Fremont, CA) was used according to the manufacturer’s instruction to measure the activity of the enzyme in each supernatant fraction obtained from the osmotic shock procedure (Tris/MgSO4 wash ...
-
bioRxiv - Pathology 2022Quote: MMP-12 assay kit was purchased from AnaSpec (Fremont, CA). Frozen liver tissue (50-75 mg ...
-
bioRxiv - Neuroscience 2023Quote: ... The SensoLyte Red Glucocerebrosidase (GBA) Activity Assay Kit (AnaSpec, AS-72259) was used to determine enzyme activity in serum and whole tissue lysate samples ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... we used a SensoLyte® HAT (p300) Assay Kit (Anaspec, Fremont, CA). Assay was conducted on a black walled 96-well petriplate (VWR ...
-
bioRxiv - Immunology 2022Quote: Elastin cleavage was examined using a SensoLyte® Green Elastase Assay Kit (AnaSpec). Porcine elastase (AnaSpec ...
-
bioRxiv - Neuroscience 2019Quote: ... Gelatinase activity was measured using the SensolyteGeneric MMP colorimetric assay kit (Anaspec, Fremont, CA). Samples were run in duplicate and end-point enzymatic activity was analyzed using a glutathione reference standard.
-
bioRxiv - Microbiology 2021Quote: ... Recombinant PfQC activities were determined using SensoLyte green glutaminyl cyclase activity assay kit (Anaspec). Briefly ...
-
bioRxiv - Immunology 2022Quote: Generic MMP function was determined using a Generic MMP Activity Kit (AnaSpec, AS-72202) as per the kit’s instructions ...
-
bioRxiv - Bioengineering 2020Quote: ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to the manufacturer’s protocol ...
-
bioRxiv - Genetics 2019Quote: ... separate cells were harvested and analyzed using the SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec) according to manufacturer’s instructions ...
-
bioRxiv - Immunology 2023Quote: ... Tetanus Toxoid (TT) was labeled with APC or PE using an AnaTag labeling kit (Anaspec) according to the manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Microbiology 2023Quote: ... Cathepsin B activity in cytosolic fractions was measured using the SensoLyte 520 Cathepsin B Assay Kit (AnaSpec) according to the manufacturer’s instructions ...
-
bioRxiv - Immunology 2021Quote: Cathepsin D (CtsD) activity was measured using the SensoLyte ® 520 Cathepsin D Assay Kit (AS-72170, Anaspec) per the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2019Quote: Activity was determined using the SensoLyte®520 ADAM10 Activity Assay Kit (AS-72226, AnaSpec Inc, Fremont, CA), which is based on the FRET substrate 5‐ FAM/QXL™520 with excitation/emission of 490/520 nm ...
-
bioRxiv - Immunology 2021Quote: ... Cathepsin L (CtsL) activity was measured using the SensoLyte ® Rh110 Cathepsin L Assay Kit (AS-72217, Anaspec) per the manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2022Quote: ... brain samples were analyzed using the Sensolyte 520 Neprilysin Activity Assay Fluorometric Kit (catalog number AS-72223, AnaSpec) and following the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: The ThT fluorescence assay was performed using the SensoLyte Thioflavin T β-Amyloid Aggregation Kit (ANASPEC, Fremont, CA, USA). Aβ and ThT solutions at final concentrations of 50 μM and 200 μM ...