Labshake search
Citations for Anaspec :
1 - 50 of 71 citations for Mouse Thymosin Beta 4 TMSB4X ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... Total anti-MOG IgG was quantified by using SensoLyte Anti-Mouse MOG(1–125) IgG Quantitative ELISA Kit (Anaspec).
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Genomics 2019Quote: ... 4 mM (83203, AnaSpec)] ...
-
bioRxiv - Bioengineering 2020Quote: ... 20 μg/ml biotin-4-fluorescein (AnaSpec, CA, USA) dissolved in PBS is added (step 3) ...
-
Neutralizing PD-L1 and PD-L2 Enhances the Efficacy of Immune Checkpoint Inhibitors in Ovarian CancerbioRxiv - Cancer Biology 2020Quote: ... and mouse anti-HIS Hilyte Fluor 488 (Anaspec).
-
bioRxiv - Biochemistry 2019Quote: ... Pre-acetylated Biotin-Histone 4 Peptide was purchased from AnaSpec (#64989-025). Bovine serum albumin fraction V (#A7888) ...
-
bioRxiv - Physiology 2021Quote: ... Di-4-ANEPPS (AnaSpec, Catalog# AS-84723, 1 µM in KH buffer), was perfused to image excitation of the heart ...
-
bioRxiv - Developmental Biology 2021Quote: ... the GLP-1 receptor agonist exendin-4 (10 nM, Anaspec (Fremont CA)) or the KATP-channel opener diazoxide (200 μM ...
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Biochemistry 2020Quote: ... All GrpE variants were labeled with DACM (N-(7-dimethylamino-4-methylcoumarin-3-yl)maleimide) (AnaSpec) and DnaK was labeled with BODIPY-fluorescein-N-(2-aminoethyl)-maleimide (Invitrogen ...
-
bioRxiv - Biochemistry 2021Quote: ... a HABA biotin quantification kit (AnaSpec) was used to measure the biotin concentrations of each solution ...
-
bioRxiv - Bioengineering 2023Quote: ... MMP-13 production was measured using an enzyme-specific fluorescence substrate kit (SensoLyte 520 MMP-13 Assay Kit; AnaSpec), according to the manufacturer’s instructions.
-
bioRxiv - Bioengineering 2023Quote: ... was determined via analysis of spent culture medium (n = 5/group/time) using a commercially available FRET-based generic MMP activity kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric; Anaspec). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Genetics 2020Quote: ... using the SensoLyte Malachite Green Assay kit (AnaSpec) in assay buffer (MgCl2 2 mmol/L ...
-
bioRxiv - Biophysics 2021Quote: ... the peptides were labeled at their N-terminus with an amine-reactive environmentally sensitive fluorescent reporter, Succinimidyl 6-(N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoate (NBD-X, SE) (AnaSpec, Fremont, CA) [37] ...
-
bioRxiv - Biophysics 2019Quote: ... was labeled at the N-terminus with succinimidyl 6-n-7-nitrobenz-2-oxa-1,3-diazol-4-yl amino hexanoate (NBD-X SE; Anaspec, Fremont, CA). Free NBD dye was removed by gel filtration using a PD-10 column (GE Healthcare Life Sciences ...
-
bioRxiv - Immunology 2021Quote: ... slides were incubated in blocking at RT for 1 h before overnight incubation at 4°C with the primary rabbit anti-P2Y12 receptor antibody (1:200, AnaSpec #AS-55043A) and labelling for 1 hour with the secondary antibody AF488 goat anti-rabbit ...
-
bioRxiv - Cell Biology 2023Quote: Analyses of MMP-2 activity were performed by a fluorescence assay kit (SensoLyte® 520 MMP-2 kit, AnaSpec, San Jose, USA). The fluorescence of the substrate cleavage product was determined at excitation/emission = 490 nm/520 nm with a Perkin-Elmer spectrofluorometer [21,22].
-
bioRxiv - Bioengineering 2024Quote: ... was determined via analysis of spent culture medium (n= 8-10/group) using a commercially available FRET-based generic MMP cleavage kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric, Anaspec, Fremont, CA). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Immunology 2021Quote: ... together with antigenic peptides (for Pmel-1, gp10025-33; for OT-1, OVA257-264) at 10μg/mouse (peptides were purchased from Anaspec). The control (CON ...
-
bioRxiv - Microbiology 2023Quote: ... Malachite green reagent (SensoLyte MG Phosphate Assay Kit [AnaSpec]) was added to each reaction and incubated for 30 min before measuring absorbance at 660 nm ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by incubation overnight at 4°C with rat anti-Mer (1:1000, eBioscience, cat# 14-5751-82) and rabbit anti-P2RY12 (1:2000, AnaSpec, cat# AS-55043A) in 2% NGS and 2% NDS in PBS-T ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Microbiology 2020Quote: The SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec, Fremont, CA) was used according to the manufacturer’s instruction to measure the activity of the enzyme in each supernatant fraction obtained from the osmotic shock procedure (Tris/MgSO4 wash ...
-
bioRxiv - Pathology 2022Quote: MMP-12 assay kit was purchased from AnaSpec (Fremont, CA). Frozen liver tissue (50-75 mg ...
-
bioRxiv - Neuroscience 2023Quote: ... The SensoLyte Red Glucocerebrosidase (GBA) Activity Assay Kit (AnaSpec, AS-72259) was used to determine enzyme activity in serum and whole tissue lysate samples ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We incubated the washed beads with 0.25 mg/mL mouse monoclonal biotinylated anti-His Tag monoclonal antibody (AS-61250-BIOT, Anaspec Inc., Fremont, CA) for 2 hours at 22°C ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... we used a SensoLyte® HAT (p300) Assay Kit (Anaspec, Fremont, CA). Assay was conducted on a black walled 96-well petriplate (VWR ...
-
bioRxiv - Immunology 2022Quote: Elastin cleavage was examined using a SensoLyte® Green Elastase Assay Kit (AnaSpec). Porcine elastase (AnaSpec ...