Labshake search
Citations for Anaspec :
1 - 50 of 101 citations for Mouse T Cell Surface Glycoprotein CD8 Beta Chain CD8B ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Immunology 2023Quote: ... Total anti-MOG IgG was quantified by using SensoLyte Anti-Mouse MOG(1–125) IgG Quantitative ELISA Kit (Anaspec).
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Bioengineering 2023Quote: ... plated at 800,000 splenocytes/well and restimulated with 10 μg rabies virus glycoprotein peptide (AnaSpec) for 24h at 37 °C ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2023Quote: MHC II Ea chain (Ea) (52–68) peptide (Anaspec) was reconstituted in sterile distilled H 2O to a final concentrate of 1mG/mL ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Cancer Biology 2023Quote: ... T cells were stimulated by addition of SIINFEKL peptide (AnaSpec, AS-60193-1) for 4 hours and expanded for 3 days prior to an experiment ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: The ThT fluorescence assay was performed using the SensoLyte Thioflavin T β-Amyloid Aggregation Kit (ANASPEC, Fremont, CA, USA). Aβ and ThT solutions at final concentrations of 50 μM and 200 μM ...
-
bioRxiv - Neuroscience 2021Quote: ... animals were immunized subcutaneously in the flanks with 400µg of myelin oligodendrocyte glycoprotein 35-55 (MOG 33-55) (MEVGWYRSPFSRVVHLYRNGK; Anaspec Inc. Catalog No. AS-60130-1) in a 200ul emulsion of Complete Freund’s Adjuvant (4mg/ml Mycobacterium tuberculosis ...
-
bioRxiv - Bioengineering 2019Quote: ... UltraPure grade Thioflavin T (ThT) (AnaSpec, Fremont, CA) was dissolved in deionized water at a concentration of 1 mM then filter-sterilized ...
-
bioRxiv - Bioengineering 2019Quote: ... UltraPure grade Thioflavin T (ThT) (AnaSpec, Fremont, CA) was dissolved in deionized water at a concentration of 1 mM then filter-sterilized ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ThT assays were performed using the SensoLyte ® Thioflavin T β-Amyloid (1 – 42) Aggregation Kit (Anaspec, Cat no: AS-72214) with slight modifications to the manufacturer’s protocol ...
-
bioRxiv - Immunology 2021Quote: ... Ex vivo stimulation of T cells was performed with 100ng/ml PMA and 1ug/ml ionomycin or 200mg/ml gp33 peptide (Anaspec) for 4-5 hours in the presence of brefeldin A ...
-
bioRxiv - Immunology 2022Quote: ... 2×106 splenocytes were plated in 96-well plates (Fisher, #130188) in 200 μL T-cell media and stimulated with the indicated peptide (SIINFEKL [Anaspec, #AS-60193-1] ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Microbiology 2020Quote: Bead surface amines were quantified using a ninhydrin-based assay per the manufacturer’s instructions (Anaspec) with slight modification ...
-
bioRxiv - Neuroscience 2023Quote: ... Aggregation was verified by Thioflavin T dye (AnaSpec, AS-88306) staining at 440Em/484Ex (38).
-
bioRxiv - Immunology 2022Quote: ... in 200 μL T-cell media and stimulated with the indicated peptide (SIINFEKL [Anaspec, #AS-60193-1], or TSYKFESV [Anaspec, #AS-64688]) at a final concentration of 2 µM for 5 hours prior to Fc block as before ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Biophysics 2023Quote: ... Residual native CaM was stripped from SR by incubation with 300 nM of the M13 skeletal muscle myosin light-chain kinase CaM-binding peptide (Anaspec, Fremont, CA, USA), as described previously [35] ...
-
bioRxiv - Genetics 2019Quote: ... separate cells were harvested and analyzed using the SensoLyte pNPP Alkaline Phosphatase Assay Kit (AnaSpec) according to manufacturer’s instructions ...
-
Neutralizing PD-L1 and PD-L2 Enhances the Efficacy of Immune Checkpoint Inhibitors in Ovarian CancerbioRxiv - Cancer Biology 2020Quote: ... and mouse anti-HIS Hilyte Fluor 488 (Anaspec).
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Biochemistry 2021Quote: ... a HABA biotin quantification kit (AnaSpec) was used to measure the biotin concentrations of each solution ...
-
bioRxiv - Bioengineering 2023Quote: ... MMP-13 production was measured using an enzyme-specific fluorescence substrate kit (SensoLyte 520 MMP-13 Assay Kit; AnaSpec), according to the manufacturer’s instructions.
-
bioRxiv - Bioengineering 2023Quote: ... was determined via analysis of spent culture medium (n = 5/group/time) using a commercially available FRET-based generic MMP activity kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric; Anaspec). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Genetics 2020Quote: ... using the SensoLyte Malachite Green Assay kit (AnaSpec) in assay buffer (MgCl2 2 mmol/L ...
-
bioRxiv - Cell Biology 2024Quote: ... ISCs (2,000 cells) and Paneth cells (2000 cells) were then seeded into 30 μl Matrigel containing 1 μM Jagged-1 (AnaSpec, San Jose, CA) and 10 μM Y-27632 ...
-
bioRxiv - Cell Biology 2023Quote: Analyses of MMP-2 activity were performed by a fluorescence assay kit (SensoLyte® 520 MMP-2 kit, AnaSpec, San Jose, USA). The fluorescence of the substrate cleavage product was determined at excitation/emission = 490 nm/520 nm with a Perkin-Elmer spectrofluorometer [21,22].
-
bioRxiv - Bioengineering 2024Quote: ... was determined via analysis of spent culture medium (n= 8-10/group) using a commercially available FRET-based generic MMP cleavage kit (SensoLyte 520 Generic MMP Activity Kit Fluorimetric, Anaspec, Fremont, CA). MMP activity is represented as the concentration of MMP cleaved product (5-FAM-Pro-Leu-OH) ...
-
bioRxiv - Immunology 2021Quote: ... together with antigenic peptides (for Pmel-1, gp10025-33; for OT-1, OVA257-264) at 10μg/mouse (peptides were purchased from Anaspec). The control (CON ...