Labshake search
Citations for Anaspec :
1 - 50 of 147 citations for IL 1 beta Rat since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by incubation overnight at 4°C with rat anti-Mer (1:1000, eBioscience, cat# 14-5751-82) and rabbit anti-P2RY12 (1:2000, AnaSpec, cat# AS-55043A) in 2% NGS and 2% NDS in PBS-T ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Microbiology 2023Quote: ... 1 μM Jagged 1 (Anaspec), 10 nM Y-27632 (Cayman Chemical Company) ...
-
bioRxiv - Immunology 2019Quote: ... 10□1 of 1□M SIINFEKL (AnaSpec) or SIIQFEKL (Q4 ...
-
bioRxiv - Developmental Biology 2022Quote: ... 1 μM Jagged-1 (Anaspec, AS-61298), 2.5 μM Thiazovivin (Selleckchem ...
-
bioRxiv - Neuroscience 2022Quote: ... β-amyloid 1-42 (Aβ42, 1 μM, Anaspec, Fremont CA)31 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 1 μM Jagged-1 (AnaSpec, Fremont, CA, USA) in Advanced DMEM/F12 (Thermo Fisher Scientific) ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 1 μM JAG-1 protein (AnaSpec AS-61298, NC0243900) in a flat bottom 48-well plate (Corning 3548) ...
-
bioRxiv - Cell Biology 2019Quote: ... 1 mg ml−1 of fluoresceinated gelatin (Gelatin-FITC,Anaspec) in PBS was injected (4-5 ng ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2021Quote: We added 1 mg Aβ peptide (1-42) (Anaspec, CA, USA) into a microtube containing 270 μL of 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2019Quote: ... or 100 μg/ml 1:1 ratio of FITC conjugated collagen (Anaspec AS-85111) and non-labelled collagen (Corning 354236 ...
-
bioRxiv - Biochemistry 2024Quote: ... and 1-hydroxybenzotriazole hydrate (Anaspec), and finally 10 equiv ...
-
bioRxiv - Cell Biology 2020Quote: ... 1 μg/ml JAG1 peptide (Anaspec), 500 nM soluble recombinant NOTCH receptor inhibitor Delta Like Ligand 4 mutant (DLL4E12) ...
-
bioRxiv - Cancer Biology 2021Quote: ... αSMA 1:100 (AS-29553, Anaspec), CD31 1:100 (MEC13.1 ...
-
bioRxiv - Cell Biology 2023Quote: ... and Hoechst stain (1:2000, AnaSpec) at room temperature in the dark for 30 min ...
-
bioRxiv - Immunology 2019Quote: ... Freshly harvested OT-1 splenocytes were stimulated with 10 nM SIINFEKL peptide (Anaspec, catalog AS-60193-1) in OT-1 culture medium supplemented with 100 U/ml mouse recombinant IL-2 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: ... and primary antibodies (rabbit anti-Iba1, 1:500 Wako #016-26461; rabbit anti-P2y12, 1:500 Anaspec #AS-55043A ...
-
bioRxiv - Neuroscience 2021Quote: ... the sections were incubated for 30 minutes in ACSF with A580 MMP Substrate 1 (1 μg/ml, Anaspec) at RT ...
-
bioRxiv - Neuroscience 2023Quote: ... The following primary antibodies were used: 1) rabbit anti-pT217-tau at 1:200 (cat# AS-54968, Anaspec). The immunogen used KLH conjugated with synthetic peptides corresponding to human tau at phosphorylated threonine 217 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12R (1:500; #55043AS, AnaSpec). After the incubation with the primaries ...
-
bioRxiv - Cell Biology 2021Quote: ... and 1mM Jagged-1 (AnaSpec AS-61298). Organoids were maintained at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... and P2RY12 (1:300, AnaSpec # AS-55043A). Sections were then washed thoroughly to remove excess antibodies and treated with fluorescently tagged secondary antibodies ...