Labshake search
Citations for Anaspec :
1 - 50 of 83 citations for Human integrin alpha 5 beta 3 His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We incubated the washed beads with 0.25 mg/mL mouse monoclonal biotinylated anti-His Tag monoclonal antibody (AS-61250-BIOT, Anaspec Inc., Fremont, CA) for 2 hours at 22°C ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Bioengineering 2023Quote: ... Me-HA was conjugated via Michael Addition with the integrin-binding RGD peptide Ac-GCGYGRGDSPG-NH2 (Anaspec) at a final concentration in the gel of 0.5 mmol/L ...
-
Neutralizing PD-L1 and PD-L2 Enhances the Efficacy of Immune Checkpoint Inhibitors in Ovarian CancerbioRxiv - Cancer Biology 2020Quote: ... and mouse anti-HIS Hilyte Fluor 488 (Anaspec).
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Biophysics 2020Quote: ... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
bioRxiv - Biochemistry 2023Quote: ... 5 mM of one of the glycopeptides (Muc5AC-3, Muc5AC-13, Muc5AC-3,13, Cst1.4, and Srs13.2 (Anaspec, Fremont, CA), 5 mM UDP-2-(acetylamino)-4-F-D-galactosamine disodium salt (UDP-GalNAc-F) ...
-
bioRxiv - Neuroscience 2020Quote: Human Aβ42 (AnaSpec) or human biotin-beta-Amyloid (1-42 ...
-
bioRxiv - Immunology 2021Quote: ... 5×106 lung cells were re-stimulated for 3 hours (37°C, 5% CO2) with 10 nM NP366–374 and PA224-233 peptides from Anaspec (Fremont, California) in the presence of Brefeldin/A from BD Biosciences (Franklin Lakes ...
-
bioRxiv - Immunology 2022Quote: ... Miltenyi Biotech) or BMDCs were stimulated for 3 h using Ova peptide 257–264 (SIINFEKL) (Cat no. AS-60193-5, AnaSpec, Fremont, CA, USA). For measuring antigen cross presentation ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: ... One mg of lyophilized human Aβ42 (Anaspec) or scrambled Aβ42 (Anaspec ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Cancer Biology 2023Quote: ... 20 nM of His-tagged BRD4 BD1 and 20 nM of biotinylated histone H4 K5/8/12/16(Ac) peptide (AnaSpec) were mixed in 20 mM HEPES pH 7.5 ...
-
bioRxiv - Cell Biology 2022Quote: Fluorescein-5-Maleimide (AnaSpec) was attached to ubiquitin following the directions as previously described 40 ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Microbiology 2019Quote: ... Next 5-TAMRA (4eq; Anaspec) was dissolved in 1 ml DMSO:NMP (1:1) ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2022Quote: ... 3% bovine serum and HiLyteFluor Texas Red-conjugated streptavidin (AnaSpec, Inc ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biochemistry 2021Quote: ... and 1 mM 5-FAM-Lysine (Anaspec), prepared from a 20 mM stock in DMSO ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2023Quote: ... 5-FAM-LC-LL-37 (AS-63694, Anaspec), Crotamine (CRO01-01000 ...