Labshake search
Citations for Anaspec :
1 - 50 of 101 citations for Human Histone H3.3C H3 5 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... histone H3K9me3 (Anaspec) were used for the experiment ...
-
bioRxiv - Genetics 2019Quote: ... H3(1-21) and H3(21-44) peptides were ordered from Anaspec, and H3(1-43 ...
-
bioRxiv - Immunology 2020Quote: Various H3 peptides (Anaspec library (https://www.anaspec.com/)) were serially diluted in DMSO (1% final assay concentration ...
-
bioRxiv - Biochemistry 2020Quote: ... and non-histone Bio-p53K382Ac (Anaspec #65046) sequences (Anaspec ...
-
bioRxiv - Biochemistry 2019Quote: ... Pre-acetylated Biotin-Histone 4 Peptide was purchased from AnaSpec (#64989-025). Bovine serum albumin fraction V (#A7888) ...
-
bioRxiv - Immunology 2023Quote: ... Total anti-MOG IgG was quantified by using SensoLyte Anti-Mouse MOG(1–125) IgG Quantitative ELISA Kit (Anaspec).
-
bioRxiv - Biophysics 2020Quote: ... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
bioRxiv - Neuroscience 2020Quote: Human Aβ42 (AnaSpec) or human biotin-beta-Amyloid (1-42 ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Immunology 2022Quote: ... was incubated with the substrate of H3(1-21) lysine 9 tri-methylated biotinylated peptide (30 nM, Anaspec), in the presence of aKG (10 μM ...
-
bioRxiv - Biochemistry 2022Quote: ... 50 nM HAT module was incubated in buffer along with 0-700 mM H3 peptide (amino acids 1-21) (AnaSpec) at 30°C in 384-well plates (Greiner Bio-One ...
-
bioRxiv - Biochemistry 2020Quote: ... was used for detection of deacetylation activity with the acetylated peptide substrates derived from histone Bio-H4K12Ac (Anaspec #64849) and non-histone Bio-p53K382Ac (Anaspec #65046 ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Cancer Biology 2023Quote: ... 20 nM of His-tagged BRD4 BD1 and 20 nM of biotinylated histone H4 K5/8/12/16(Ac) peptide (AnaSpec) were mixed in 20 mM HEPES pH 7.5 ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: ... One mg of lyophilized human Aβ42 (Anaspec) or scrambled Aβ42 (Anaspec ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: Fluorescein-5-Maleimide (AnaSpec) was attached to ubiquitin following the directions as previously described 40 ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Microbiology 2019Quote: ... Next 5-TAMRA (4eq; Anaspec) was dissolved in 1 ml DMSO:NMP (1:1) ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biochemistry 2021Quote: ... and 1 mM 5-FAM-Lysine (Anaspec), prepared from a 20 mM stock in DMSO ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2023Quote: ... 5-FAM-LC-LL-37 (AS-63694, Anaspec), Crotamine (CRO01-01000 ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Molecular Biology 2021Quote: ... After the addition of 15 µl of 5× click reaction buffer (7.5 mM sodium ascorbate [Nacalai Tesque], 0.5 mM TBTA [AnaSpec], and 5 mM CuSO4) and 1.5 µl of 10 mM Azide-PEG4-Biotin (Click Chemistry Tools) ...
-
bioRxiv - Biophysics 2021Quote: ... 5-FAM fluorlabeled Crosstide was from AnaSpec (Fremont, CA). C1 peptide was from Promega (Madison ...
-
bioRxiv - Biochemistry 2023Quote: ... One mg of each protein was labeled with a 10-fold molar excess of TMR 5-iodoacetamide (5-TMRIA; Anaspec, San Jose, CA) per cysteine (from a stock concentration of 20 mM in dimethylformamide ...
-
bioRxiv - Biochemistry 2020Quote: Stock solutions of HiLyte™ Fluor 488- labeled Human Aβ42 (Aβ, 0.1 mg; AnaSpec, USA) were prepared by dissolving the lyophilized peptide (1% NH4OH ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Biochemistry 2022Quote: ... N-methylanthraniloyl guanosine-5’-triphosphate (mant-GTP) was obtained from AnaSpec. Glutaraldehyde was purchased from Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Cell Biology 2019Quote: ... differentiated SH-SY5Y cells were incubated with 5 μM TAT-TAMRA (AnaSpec) and 3 μM α-synPFF-AF488 either in the presence or in the absence of 250 μM polyP ...
-
bioRxiv - Immunology 2023Quote: ... 4μM of OVA (OVA 257-264, Anaspec Inc., Cat#AS-60193-5) or gp33 (gp33-41 ...
-
bioRxiv - Microbiology 2020Quote: ... Ubiquitin was further cross-linked with fluorescein-5-maleimide (Anaspec, Fremont, CA, US) and the poly-ubiquitination sample was generated following previous protocol 49 ...
-
bioRxiv - Biophysics 2021Quote: ... actin was labeled at Cys374 with erythrosin-5’-iodoacetamide (ErIA; AnaSpec, Fremont, CA)(11,14) ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Cell Biology 2019Quote: ... following the manufacturer’s instructions (SensoLyte p300 Assay kit, SensoLyte PCAF Assay kit, Anaspec) using appropriate dilutions of NDGA and anacardic acid ...
-
bioRxiv - Cell Biology 2021Quote: ... and Aβ-TMR (Aβ1–42-5-tetramethyl rhodamin) suspended in 1,1,1,3,3,3-hexafluoro-2-propanol (AnaSpec). Lyophilized Aβ and Aβ-TMR were resuspended at a concentration of 5 mM in Me2SO and then diluted to a concentration of 100 μM in HEPES buffer ...