Labshake search
Citations for Anaspec :
1 - 50 of 144 citations for HCV 1 e2 Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2019Quote: ... The reaction was initiated by the injection of 5 µL of HCV NS3/4A protease substrate (AnaSpec) using a Perkin-Elmer EnVision plate reader ...
-
bioRxiv - Biochemistry 2021Quote: ... The proteolytic reaction was initiated by the injection of 5 μL of HCV NS3/4A protease substrate (AnaSpec), to a final concentration of 200 nM and kinetically monitored using a Perkin Elmer EnVision plate reader (excitation at 485 nm ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 1 μM JAG-1 protein (AnaSpec AS-61298, NC0243900) in a flat bottom 48-well plate (Corning 3548) ...
-
bioRxiv - Biochemistry 2019Quote: ... MGP 1-64 (the first 64 amino acids of matrix Gla protein, Anaspec), 1 uM ...
-
bioRxiv - Molecular Biology 2022Quote: ... Purified SIINFEKL peptide from ovalbumin protein (AnaSpec) was added to cells at 25 µg/ml for 4h ...
-
bioRxiv - Microbiology 2023Quote: ... 1 μM Jagged 1 (Anaspec), 10 nM Y-27632 (Cayman Chemical Company) ...
-
bioRxiv - Immunology 2019Quote: ... 10□1 of 1□M SIINFEKL (AnaSpec) or SIIQFEKL (Q4 ...
-
bioRxiv - Developmental Biology 2022Quote: ... 1 μM Jagged-1 (Anaspec, AS-61298), 2.5 μM Thiazovivin (Selleckchem ...
-
bioRxiv - Neuroscience 2022Quote: ... β-amyloid 1-42 (Aβ42, 1 μM, Anaspec, Fremont CA)31 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 1 μM Jagged-1 (AnaSpec, Fremont, CA, USA) in Advanced DMEM/F12 (Thermo Fisher Scientific) ...
-
bioRxiv - Cell Biology 2019Quote: ... 1 mg ml−1 of fluoresceinated gelatin (Gelatin-FITC,Anaspec) in PBS was injected (4-5 ng ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Neuroscience 2021Quote: We added 1 mg Aβ peptide (1-42) (Anaspec, CA, USA) into a microtube containing 270 μL of 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Neuroscience 2019Quote: ... Single cells were re-plated onto matrigel treated coverslips at low density in the presence of 10nM PACAP protein (AnaSpec) or 0.01% DMSO (Sigma) ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Bioengineering 2022Quote: ... ACE2-expressing HEK293T and HEK293T control cells were lysed and the activity of the ACE protein was assessed by the SensoLyte 390 ACE2 Activity Assay Kit (AnaSpec, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2019Quote: ... or 100 μg/ml 1:1 ratio of FITC conjugated collagen (Anaspec AS-85111) and non-labelled collagen (Corning 354236 ...
-
bioRxiv - Biochemistry 2024Quote: ... and 1-hydroxybenzotriazole hydrate (Anaspec), and finally 10 equiv ...
-
bioRxiv - Cell Biology 2020Quote: ... 1 μg/ml JAG1 peptide (Anaspec), 500 nM soluble recombinant NOTCH receptor inhibitor Delta Like Ligand 4 mutant (DLL4E12) ...
-
bioRxiv - Cancer Biology 2021Quote: ... αSMA 1:100 (AS-29553, Anaspec), CD31 1:100 (MEC13.1 ...
-
bioRxiv - Cell Biology 2023Quote: ... and Hoechst stain (1:2000, AnaSpec) at room temperature in the dark for 30 min ...
-
bioRxiv - Biochemistry 2023Quote: ... One mg of each protein was labeled with a 10-fold molar excess of TMR 5-iodoacetamide (5-TMRIA; Anaspec, San Jose, CA) per cysteine (from a stock concentration of 20 mM in dimethylformamide ...
-
bioRxiv - Immunology 2019Quote: ... Freshly harvested OT-1 splenocytes were stimulated with 10 nM SIINFEKL peptide (Anaspec, catalog AS-60193-1) in OT-1 culture medium supplemented with 100 U/ml mouse recombinant IL-2 (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: ... and primary antibodies (rabbit anti-Iba1, 1:500 Wako #016-26461; rabbit anti-P2y12, 1:500 Anaspec #AS-55043A ...
-
bioRxiv - Neuroscience 2021Quote: ... the sections were incubated for 30 minutes in ACSF with A580 MMP Substrate 1 (1 μg/ml, Anaspec) at RT ...
-
bioRxiv - Neuroscience 2023Quote: ... The following primary antibodies were used: 1) rabbit anti-pT217-tau at 1:200 (cat# AS-54968, Anaspec). The immunogen used KLH conjugated with synthetic peptides corresponding to human tau at phosphorylated threonine 217 ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12R (1:500; #55043AS, AnaSpec). After the incubation with the primaries ...
-
bioRxiv - Cell Biology 2021Quote: ... and 1mM Jagged-1 (AnaSpec AS-61298). Organoids were maintained at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... and P2RY12 (1:300, AnaSpec # AS-55043A). Sections were then washed thoroughly to remove excess antibodies and treated with fluorescently tagged secondary antibodies ...
-
bioRxiv - Biochemistry 2021Quote: ... and 1 mM 5-FAM-Lysine (Anaspec), prepared from a 20 mM stock in DMSO ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-P2RY12 (1:1000; AnaSpec, Fremont, CA), anti-GFAP (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-P2ry12 (AS-55043A, AnaSpec, 1:1000), anti-Tmem119 (ab209064 ...
-
bioRxiv - Microbiology 2023Quote: ... 0.5 µg LL-37 ml-1 (Anaspec), or both.
-
bioRxiv - Immunology 2021Quote: ... together with antigenic peptides (for Pmel-1, gp10025-33; for OT-1, OVA257-264) at 10μg/mouse (peptides were purchased from Anaspec). The control (CON ...
-
bioRxiv - Microbiology 2021Quote: ... pneumoniae cells were induced to competence by the addition of synthetic competence stimulatory peptide 1 (CSP-1; Anaspec, Inc.). Markerless deletions and replacements of target genes were constructed using the kanR-rpsL+ (Janus cassette ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2023Quote: OT-1 T-cells were isolated from OT-1 mice by culturing OT-1 splenocytes in T-cell media supplemented with 50IU/mL IL-2 and 1 μM OVA SIINFEKL peptide (Anaspec) for 48 h ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit anti-P2ry12 (1:500, Anaspec, AS-55043A); goat anti-Pdgfr-α (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-P2Y12 (1:400, Anaspec, AS-55043A), rabbit anti-Iba1 (1:500 ...
-
bioRxiv - Biochemistry 2021Quote: Synthetic Aβ(1-40) was purchased from AnaSpec Inc ...