Labshake search
Citations for Aves Labs :
1 - 50 of 389 citations for Recombinant Chicken CSF3 Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2021Quote: ... chicken α-Green Fluorescence Protein (GFP) (Aves Labs, Inc., GFP-1010), and goat α-Choline Acetyltransferase (ChAT ...
-
bioRxiv - Neuroscience 2024Quote: ... chicken anti-green fluorescent protein (1:1000 [GFP-1020, Aves Labs, CA]), Guinea pig anti-VGAT (Synaptic Systems #131004) ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-green fluorescent protein (GFP) from chicken (Aves Labs, Cat#1020; 1:500), anti-CRE from rabbit (Novagen ...
-
bioRxiv - Plant Biology 2023Quote: ... AD and BD fusion proteins were detected with a chicken HA epitope antibody (Aves Labs) and a rabbit LexA binding domain antibody (Clontech) ...
-
bioRxiv - Cell Biology 2023Quote: ... GFP (chicken, Aves Labs, GFP-1020 ...
-
bioRxiv - Neuroscience 2021Quote: ... The following primary antibodies were then used: chicken anti-Green Fluorescent Protein (GFP, 1:1000; Aves Labs), rabbit anti-Red Fluorescence Protein (RFP ...
-
bioRxiv - Developmental Biology 2019Quote: ... then incubated overnight at 4°C in combined primary antibodies (chicken anti-green fluorescent protein [GFP]; Aves Labs, Tigard ...
-
A Polybasic Domain in aPKC Mediates Par6-Dependent Control of Membrane Targeting and Kinase ActivitybioRxiv - Cell Biology 2020Quote: ... chicken anti-GFP (Aves Lab) 1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (Aves labs), goat anti-IBA1 (Novus) ...
-
bioRxiv - Developmental Biology 2023Quote: ... chicken anti-GFP (Aves Labs) 1:1000 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (Aves lab; RRID:AB_2307313), goat anti-GFP (Sicgen ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-MBP (Aves lab; RRID:AB_2313550), rabbit anti-GFAP (Agilent ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken αGFP (GFP-1020, Aves Labs), rabbit αPROXl (ab101851 ...
-
bioRxiv - Cell Biology 2022Quote: ... 1407 Chicken anti-PG (Aves Laboratories); 2G9 Mouse anti-B55α (Cell Signaling Technology) ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken polyclonal anti-GFP (Aves Lab, GFP-1020 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-green fluorescent protein (GFP, Cat#GFP-1020, RRID: AB_10000240) antibody was purchased from Aves Labs (Tigard, Oregon, USA). Rabbit anti S100β (Cat# Z0311 ...
-
bioRxiv - Genetics 2021Quote: ... chicken anti-GFP (1:500, Aves Labs), Rabbit anti-cleaved Dcp-1 (1:100 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rhodamine phalloidin (1:1000 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken anti-GFP (Aves Lab, GFP-1010), 1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:250 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000; Aves Labs), rabbit anti-DsRed (1:500 ...
-
bioRxiv - Developmental Biology 2021Quote: ... chicken GFP (Aves Labs, cat. #GFP-1020), mouse Sox2 (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-NF (1:1,000, Aves labs), SMI312 mouse anti-phospho-NF (1:500 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFAP (1:500; Aves Labs), rat anti-PDGFrα (1:100 ...
-
bioRxiv - Biophysics 2021Quote: ... Chicken anti-GFP (GFP-1010, Aves Labs); Mouse anti-GFP (2A3 ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs). Secondary antibodies conjugated to Alexa Fluor 488/647 (Jackson ImmunoResearch ...
-
bioRxiv - Neuroscience 2020Quote: ... chicken anti-GFP (1:1000; Aves Labs); mouse anti-Elav (9F8A9 ...
-
bioRxiv - Neuroscience 2020Quote: ... Chicken anti-GFP (1:3000; Aves Lab), mouse anti-parvalbumin (1:3000 ...
-
bioRxiv - Physiology 2020Quote: ... chicken anti-GFP 1:1000 (Aves Labs), mouse anti-HuC/D 1:400 (ThermoFisher) ...
-
bioRxiv - Neuroscience 2020Quote: ... GFP (1:500, chicken, Aves Labs, AB_10000240), Iba1 (1:500 ...
-
bioRxiv - Neuroscience 2021Quote: ... chicken anti-GFP (1:1000, Aves Labs), and rabbit anti-DsRed (1:500 ...
-
bioRxiv - Neuroscience 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs) and rat anti-PDF (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... anti-GFP (1:1000, chicken, Aves Lab), anti-RFP (1:1000 ...
-
bioRxiv - Cell Biology 2022Quote: ... chicken anti-GFP (Aves labs, GFP-1020), chicken anti-beta-Galactosidase (abcam ...
-
McIdas localizes at centrioles and controls centriole numbers through PLK4-dependent phosphorylationbioRxiv - Molecular Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rat anti-Cep135 (1:500 ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (Aves labs, 1:500), mouse anti-myc 9E10 (Abcam ...
-
bioRxiv - Microbiology 2019Quote: ... or PrecipHen for chicken antibodies (Aves Labs) were used to clear cell lysates at 4°C for 3 h ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-EGFP (AVES Lab, 1:1000); and mouse anti-TRESK (1:1000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Anti-Alms1a and Alms1b antibody were generated by injecting peptides (QEMEVEPKKQLEKEQHQNDMQQGEPKGREC ...
-
bioRxiv - Neuroscience 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs), goat anti-mouse IgG1 Alexafluor488 (1:500 ...
-
bioRxiv - Developmental Biology 2019Quote: ... chicken anti-GFP (1:1000, Aves Labs). Secondary antibodies were obtained from Jackson Laboratories ...
-
12-Lipoxygenase Governs the Innate Immune Pathogenesis of Islet Inflammation and Autoimmune DiabetesbioRxiv - Immunology 2021Quote: ... 1:200 chicken anti-GFP (Aves Labs). Primary antibodies were detected with 1:500 dilutions of complementary Alexa-conjugated secondary antibodies (Jackson ImmunoResearch) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-GFP (Aves Labs, GFP-1010, chicken).
-
bioRxiv - Evolutionary Biology 2022Quote: ... Primary antibodies (chicken alpha-GFP, Aves Labs: GFP-1010 and rabbit alpha-Ki67 ...
-
bioRxiv - Developmental Biology 2022Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-pH3 (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves Labs), rabbit anti-mStrawberry (1:1000 ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-YFP (chicken, Aves labs, 1:1,000), anti-Pdgfra (rabbit ...
-
bioRxiv - Neuroscience 2023Quote: ... chicken anti-GFP (1:1000, Aves labs), rabbit anti-DsRed (1:1000 ...
-
bioRxiv - Neuroscience 2024Quote: ... anti-GFP (chicken) 1/500 (Aves Lab).
-
bioRxiv - Cell Biology 2024Quote: Chicken polyclonal GFP (GFP-1010, Aves Labs): 1/500 IF