Labshake search
Citations for Sartorius :
1 - 50 of 85 citations for Radio Flow Detectors since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2022Quote: ... Flow cytometric data were acquired on an iQue 3 high-throughput flow cytometry system (Sartorius). Data were analyzed using FlowJo v10 (FlowJo).
-
bioRxiv - Immunology 2024Quote: ... Binding was read by flow cytometry on an IntelliCyte High Throughput Flow Cytometry (IntelliCyte/Sartorius).
-
bioRxiv - Cancer Biology 2023Quote: ... The filtrate was then concentrated using a tangential flow filter with a 100 kDa membrane (Viva-flow 50R, Sartorius), followed by ultrafiltration using 100 kDa Amicon Ultra-15 units (Milex ...
-
bioRxiv - Biochemistry 2023Quote: ... using a tangential flow filtration system from Sartorius, Göttingen ...
-
bioRxiv - Genomics 2024Quote: ... and flow cytometry (IntelliCyt iQue Screener Plus; Sartorius) on day 6 post-electroporation ...
-
bioRxiv - Immunology 2022Quote: ... Flow cytometry was performed on an iQue3 instrument (Sartorius) with a sip rate of 1.5 ul/s for 18s ...
-
bioRxiv - Bioengineering 2023Quote: ... or a Tangential Flow Filtration (TFF) membrane (Sartorius, 30 kDa). The mRNA-LNP concentrates were sterilized through a 0.22-micron filter ...
-
bioRxiv - Microbiology 2023Quote: ... the filtrates were firstly filtered through tangential flow filtration equipment (TFF) with a 100 kDa tangential flow membrane package (Sartorius, VIVAFLOW 50 100,000 MWCO, Germany), and then continuously concentrated until ∼1 mL solution using 100 kDa centrifugal filter units (Amicon® Ultra-15 ...
-
bioRxiv - Microbiology 2023Quote: ... part of 0.22 μm filtrate was filtered through tangential flow filtration equipment (TFF) with a 100 kDa tangential flow membrane package (Sartorius, VIVAFLOW 50 100,000 MWCO, Germany) to obtain virus-free production water ...
-
bioRxiv - Synthetic Biology 2021Quote: ... The flow-through was desalted using Vivaspin 500 (3000 MWCO) concentrators (Sartorius). The obtained RNA was reversed-transcribed and PCR-amplified using the Superscript III One Step RT-PCR system (Invitrogen ...
-
bioRxiv - Microbiology 2021Quote: ... The flow-through was concentrated using Vivaspin 20 concentrators (30 kDa MWCO, Sartorius). Concentrated protein was further purified by size exclusion chromatography on a HiLoad 26/600 Superdex 200 pg column (Cytiva) ...
-
bioRxiv - Immunology 2021Quote: ... Cells were analyzed using an iQue High-Throughput Flow Cytometer (Sartorius, Göttingen, Germany). EC50 values were calculated in GraphPad Prism.
-
bioRxiv - Microbiology 2019Quote: ... The filtrate was concentrated using a tangential flow filtration system (Vivaflow 200, Sartorius) with a 100 kDa molecular mass cutoff ...
-
bioRxiv - Cancer Biology 2022Quote: ... the plates were run on an iQue3 high-throughput flow cytometer screener (Sartorius), which facilitated multiplex cell analysis and subclone specific drug screening ...
-
bioRxiv - Microbiology 2023Quote: ... and flow through was concentrated using Vivaspin® 500 centrifugal concentrator (10,000 MWCO, Sartorius). Expression of OapAt was then confirmed using Western blot (Supplementary Figure 15A).
-
bioRxiv - Microbiology 2023Quote: ... Mean cellular fluorescence was detected by flow cytometry (Intellicyt iQue Screener PLUS, Sartorius AG).
-
bioRxiv - Immunology 2021Quote: ... and mean cellular fluorescence was detected using a high-throughput Intellicyte iQue flow cytometer (Sartorius). Antibody reactivity against each mutant spike protein clone was calculated relative to wild-type spike protein reactivity by subtracting the signal from mock-transfected controls and normalizing to the signal from wild-type S-transfected controls ...
-
bioRxiv - Bioengineering 2021Quote: ... samples were filtered through 0.45 μm pore size membrane filter (Minisart High Flow, Sartorius, Germany). A volume of 10 μL was injected into the instrument for analysis.
-
bioRxiv - Microbiology 2021Quote: ... and 10x concentrated using a tangential flow cassette (100 kDa PES Vivaflow 200, Sartorius, Germany). Approximately 5 mL of the concentrated virome were added to 20 mL of Lysogeny Broth (LB) ...
-
bioRxiv - Immunology 2022Quote: ... and mean cellular fluorescence was detected using a high-throughput Intellicyt iQue flow cytometer (Sartorius). Antibody reactivity against each mutant spike protein clone was calculated relative to wild-type spike protein reactivity by subtracting the signal from mock-transfected controls and normalizing to the signal from wild-type spike-transfected controls ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... A tangential flow filtration (TFF, VIVAFLOW 200, MWCO 100,000 PES, Sartorius Stedim Biotech GmbH, Germany) was used to remove non-incorporated HCQ and ethanol to obtain the liposomal HCQ in 0.9% sodium chloride (Merck KGaA ...
-
bioRxiv - Immunology 2021Quote: ... and mean cellular fluorescence was detected using a high-throughput Intellicyte iQue flow cytometer (Sartorius). Antibody reactivity against each mutant S protein clone was calculated relative to wild-type S protein reactivity by subtracting the signal from mock-transfected controls and normalizing to the signal from wild-type S-transfected controls ...
-
bioRxiv - Immunology 2021Quote: ... and mean cellular fluorescence was detected using a high-throughput Intellicyte iQue flow cytometer (Sartorius). Antibody reactivity against each mutant S protein clone was calculated relative to wild-type S protein reactivity by subtracting the signal from mock-transfected controls and normalizing to the signal from wild-type S-transfected controls ...
-
bioRxiv - Microbiology 2023Quote: ... and % GFP positive cells were enumerated by flow cytometry (Intellicyt iQue Screener PLUS, Sartorius AG). Infectious titers were determined from the most linear portions of the dose-response infectivity curves using the following formula ...
-
bioRxiv - Microbiology 2023Quote: ... EVs in the flow through were then concentrated with Vivaspin® 20 (10,000 MWCO, Sartorius). The filters were washed three times with 22% BSW to remove residual unincorporated 14C uracil and subsequently concentrated to 500 µL of radiolabeled EVs per replicate ...
-
bioRxiv - Microbiology 2023Quote: ... before concentrating and washing the virions by 100 kDa tangential flow filtration (Vivaflow 200, Sartorius). The concentrated viral lysates were sterile-filtered through a 0.22 µm filter (PVDF ...
-
bioRxiv - Cell Biology 2023Quote: Low molecular weight alginate (L3, Kimica) was purified using a tangential flow filtration system (Sartorius) and subsequently coupled with GGGRGDSP peptide (Biomatik ...
-
bioRxiv - Immunology 2024Quote: ... beads were resuspended in FACS buffer and acquired on flow cytometer iQue®3 (Sartorius). Population gating and analysis of fluorescence intensity were performed with iQue Forecyt software ...
-
bioRxiv - Immunology 2024Quote: ... beads were resuspended in FACS buffer and acquired on flow cytometer iQue®3 (Sartorius). Population gating and analysis of fluorescence intensity were performed with iQue Forecyt software ...
-
bioRxiv - Microbiology 2019Quote: ... and GFP positive cells quantified by flow cytometry (Intellicyt iQue Screener PLUS, Sartorius AG, Gottingen, Germany).
-
bioRxiv - Biochemistry 2020Quote: ... approximately 2000 cells per well were measured with the IntelliCyt® iQue Screener flow cytometer (Sartorius) and analyzed using ForeCyt analysis software (Sartorius) ...
-
bioRxiv - Microbiology 2020Quote: ... or by tangential flow filtration with a Vivaflow 50R 30,000 MWCO Hydrosart filter (Sartorius, Gottingen, Germany). Supernatants were treated with 200 µg/mL DNase I and 1 µg/mL RNase A for 1 hr at room temperature to remove unprotected DNA and RNA ...
-
bioRxiv - Microbiology 2022Quote: ... 10 times using a tangential flow filtration with a 100 kDa cut-off (Vivaflow, Sartorius, Germany) to 200 mL ...
-
bioRxiv - Bioengineering 2023Quote: ... The final solutions were filtered using a tangential flow filtration system (10,000 kDa MW cutoff; Sartorius) with four filtration volumes of ultrapure water ...
-
bioRxiv - Microbiology 2023Quote: ... and GFP positive cells quantified by flow cytometry (Intellicyt iQue Screener PLUS, Sartorius AG, Gottingen, Germany).
-
bioRxiv - Cell Biology 2023Quote: ... The flow-through containing the peptide was concentrated by centrifugation (Vivaspin 20, 3,000 MWCO PES, Sartorius) and subjected to SEC (Superdex 75 10/300 GL ...
-
bioRxiv - Microbiology 2024Quote: ... The fecal supernatant was filtered through a 0.45 µm Minisart High Flow PES syringe filter (Sartorius) to remove bacteria and other larger particles ...
-
bioRxiv - Microbiology 2019Quote: ... Mean cellular fluorescence was detected using a high throughput flow cytometer (Intellicyt iQue Screener Plus, Sartorius AG). Antibody reactivity against each mutant protein clone was calculated relative to reactivity with wild-type prM/E ...
-
bioRxiv - Microbiology 2019Quote: ... was used for intracellular staining to detect infected cells by flow cytometry (Intellicyt iQue Screener PLUS, Sartorius AG). Neutralization assays were performed as described below ...
-
bioRxiv - Biochemistry 2021Quote: ... before concentration on a tangential flow filtration system equipped with a 30 kDa cut-off filter membrane (Sartorius). The ~200 mL retentate was equilibrated to 20 mM imidazole ...
-
bioRxiv - Microbiology 2021Quote: ... Flow-through and wash fractions were pooled and concentrated using Vivaspin 15R concentrators (2 kDa MWCO HY, Sartorius).
-
bioRxiv - Microbiology 2020Quote: ... and supernatant filtered through a 0.45 μm PES filter (Minisart® High Flow Syringe Filter, Sartorius, Göttingen, Germany). Twice daily on days 1 and 2 ...
-
bioRxiv - Microbiology 2023Quote: ... and subjected to analysis by flow cytometry using an iQue3 Screener PLUS (Intellicyt) with IntelliCyt ForeCyt Standard Edition version 8.1.7524 (Sartorius) software.
-
bioRxiv - Immunology 2023Quote: ... EVs were then aditionally separated and concentrated 10X by tangential flow filtration (TFF, Sartorius Vivaflow 100 kDa MWCO). Some TFF-concentrated EVs were fluorescently labeled with 200 nM MemGlow 700 nm dye (Cytoskeleton ...
-
bioRxiv - Microbiology 2023Quote: ... GFP expression was measured by flow cytometry using an iQue3 Screener PLUS (Intellicyt) with IntelliCyt ForeCyt Standard Edition version 8.1.7524 (Sartorius) software ...
-
bioRxiv - Cell Biology 2024Quote: ... Large volumes of EV containing media was concentrated by using tangential cross flow ultrafiltration (100 kDa MWCO, Sartorius). EVs were collected in a refrigerated ultracentrifuge at 100,000-110,000 xg for 90 min (Optima XPN-100 ultracentrifuge using a SW28 or SW32Ti rotor ...
-
bioRxiv - Neuroscience 2021Quote: ... The clarified supernatant containing the AAV was concentrated using a cross-flow cassette (Vivaflow 50, 100,000MWCO, Sartorius; Goettingen, Germany) or Amicon Ultra-15 (100,000MWCO ...
-
bioRxiv - Cancer Biology 2021Quote: ... the 10,000xg supernatant was concentrated down to 1.0 ml with a 10 kDa molecular weight cut-off Vivaflow 50 R tangential flow (TFF) device (Sartorius) and a 10 kDa Amicon Ultra-15 centrifugal filter unit (Merck Millipore ...
-
bioRxiv - Biochemistry 2022Quote: ... The flow through and first low salt wash were pooled and concentrated using a VIVASPIN20 30,000 MWCO (Sartorius, Generon), followed by centrifugation at 17,000g for 15 minutes at 4 °C ...
-
bioRxiv - Genetics 2022Quote: ... Bacterial concentration was determined by flow cytometry (Becton Dickinson LSRFortessa) such that 150,000 spirochetes per well of an ImageLock 96-well plate (Sartorius) were incubated with either 8µg/mL or 16µg/mL of variant (TP607036;MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDA PLEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV ...