Labshake search
Citations for ProteoGenix :
1 - 28 of 28 citations for RPL39L Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2020Quote: Peptides (Proteogenix) were received as dry powder and reconstituted with water for use ...
-
ENGRAILED-1 transcription factor has a paracrine neurotrophic activity on adult spinal α-motoneuronsbioRxiv - Neuroscience 2023Quote: ... The peptides (ProteoGenix) were co-injected with hEN1 at a 20-fold molar excess of peptides ...
-
bioRxiv - Biophysics 2021Quote: ... A GlyGlyGlyCys peptide (Proteogenix, Schiltigheim, France), was dissolved in MeOH to 10 mM and added in a 6:1 ratio to 300 μM oligo-maleimide and incubated for 1h at 37°C ...
-
bioRxiv - Biochemistry 2022Quote: ... NUT peptides were ordered from Proteogenix.
-
bioRxiv - Biochemistry 2022Quote: ... peptide substrate QPKK(Ac),50 µM (Proteogenix), Herring sperm DNA (0.32 mg/ml) ...
-
bioRxiv - Cell Biology 2023Quote: Synthetic biotinylated peptides were purchased from ProteoGenix, France ...
-
bioRxiv - Synthetic Biology 2020Quote: Peptides for GFP splicing were sourced from Proteogenix, France ...
-
bioRxiv - Synthetic Biology 2020Quote: The peptides used in this study (Proteogenix, France) were protected at the N- and C-termini by acetylation and amidation ...
-
bioRxiv - Cell Biology 2022Quote: ... TAMRA(5-Carboxytetramethylrhodamine)-peptides were synthetized by ProteoGenix (France).
-
bioRxiv - Biochemistry 2021Quote: The peptides were synthesized in solid phase using Fmoc strategy (Proteogenix) encompassing a biotinyl group ...
-
bioRxiv - Biochemistry 2021Quote: The lyophilized TOST-1 and PID-1 peptides were purchased from Proteogenix at 95 % purity ...
-
bioRxiv - Biochemistry 2019Quote: ... Integrin β3 cytoplasmic tail peptide (Uni-Prot ID: P05106 CKFEEERARAKWDTANNOLYKEATSTFTNI TYRGT, ProteoGenix, Schiltgheim, France) was coupled onto CM5 chip (GE healthcare ...
-
A pectin-binding peptide with a structural and signaling role in the assembly of the plant cell wallbioRxiv - Plant Biology 2023Quote: ... RALF22R82A,R90A,R100A (AQKKYISYGAMARNSVPCSARGASYYNCQAGAQANPYSRGCSTITRCRR) and RALF22Y75A,Y78A (AQKKAISAGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR) peptides were chemically synthesized (ProteoGenix, Schiltigheim, France).
-
bioRxiv - Bioengineering 2023Quote: ... The peptide solution (CGGRGDSPG, Proteogenix, free of TFA, 1.6 mg/ mL in PBS; 2 mL) was added to the emulsion and incubated for 1 h at room temperature ...
-
bioRxiv - Biochemistry 2021Quote: The palustrin-Ca peptide (MW=3304 g mol-1, purity >95%) was purchased from ProteoGenix (Paris). 4.5 g of the peptide was dissolved in 0.6 mL of a 50% (v/v ...
-
bioRxiv - Molecular Biology 2023Quote: Two peptides spanning two parts of the p53 coding sequence were synthesized by ProteoGenix (Schiltigheim, France): PD74 ...
-
bioRxiv - Neuroscience 2020Quote: ... Preabsorption controls in human sections were performed by using the APP C-terminal peptide sequence KMQQNGYENPTYKFFEQMQN (Proteogenix) at 1 μg/ml and Y188 or C1/6.1 at 1 μg/ml (equal mass concentration ...
-
bioRxiv - Biochemistry 2021Quote: The biotinylated peptide (sequence Biotin-(PEG3)-GFQNTDDVQTSF)(Figure 1C) was synthesized in solid phase using Fmoc strategy (Proteogenix). The sequence encompasses a biotinyl group ...
-
bioRxiv - Biochemistry 2022Quote: Three BH3 peptides derived from TCTP and from the E3 ubiquitine ligase Mule (UniProtKB - Q7Z6Z7) were purchased (Proteogenix) (Fig ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM mutated TAMRA-C-ter BDNF peptide (CellPDD predicting score = 0.03, i.e. mutation abolishing the CPP characteristics : TAMRA-KKEIGWRFIRIDTSCVCTLTIKEGR-COOH; Proteogenix, France), with 1 μM TAMRA-penetratin (positive control ...
-
bioRxiv - Microbiology 2022Quote: ... The peptide corresponding to the periplasmic extension of ExbBsm (A1PAANPAVTESVAPTTAPAPAAAAPESITPVNPAPTIQPPETRG44-numbering with reference to the mature protein) was synthetized by Proteogenix.
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Biochemistry 2019Quote: ... Protein concentration was kept constant equal to 25 μM throughout the experiment and different concentrations of pITAM peptide from CD3ε chain (UniProt ID: P07766, NPDpYEPIRKGQRDLpYSGLNQR, ProteoGenix) ranging from 6.25 to 100 μM were added to the protein ...
-
bioRxiv - Evolutionary Biology 2020Quote: Standard minimum inhibitory concentration broth microdilution assays in the presence of BSA/acetic acid were performed in triplicate as described in [65] using peptides chemically synthesised to ≥95% purity (Proteogenix). Dilution series are based on net peptide content ...
-
bioRxiv - Immunology 2023Quote: ... naïve T-cells were seeded in 96-well U-bottom together with bone marrow-derived dendritic cells (BMDCs) loaded with the indicated OVA peptide (Proteogenix) at 10 ng/mL or antibodies ...
-
bioRxiv - Microbiology 2023Quote: Peptides corresponding to the amyloidogenic regions detected within the TasA amyloid core were synthetically produced and purified by Proteogenix (Schiltigheim, France). The sequence of the peptides was ...
-
bioRxiv - Cell Biology 2019Quote: ... were synthetized either by the peptide synthesis facility of the Institut de Biologie Paris-Seine (FR3631, Sorbonne Université, CNRS) or by ProteoGenix (Schiltigheim, France). A human embryonic kidney cell line (HEK293) ...
-
bioRxiv - Plant Biology 2023Quote: ... was codon-optimized for Pichia pastoris and synthesized without signal peptide in frame with His-tag in pPCIZ-αB by ProteoGenix (Schiltigheim, France). rTBL38 was produced in P ...