Labshake search
Citations for Agilent :
601 - 650 of 1327 citations for SARS Coronavirus Spike Glycoprotein S2 Mosaic C Term E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2019Quote: DNA cloning was performed using chemically competent Escherichia coli XL-10 Gold (Agilent Technologies) grown in LB medium (5 g L−1 yeast extract ...
-
bioRxiv - Biophysics 2019Quote: ... The recombinant plasmid was subsequently transformed into Escherichia coli BL21 (DE3) cells (Agilent Technologies) for protein expression ...
-
bioRxiv - Biochemistry 2021Quote: ... All Mtr4 proteins were recombinantly expressed in Escherichia coli BL21-CodonPlus (DE3)-RIPL (Stratagene) using an autoinduction protocol (Studier ...
-
bioRxiv - Biochemistry 2021Quote: The KlNmd4 protein was expressed in Escherischia coli BL21(DE3) Gold strain (Agilent technologies) using pMG897 plasmid and 1 L of auto-inducible terrific broth media (ForMedium AIMTB0260 ...
-
bioRxiv - Biochemistry 2022Quote: ... coli (e.g. Invitrogen TOP10, cat. no. C404003; Agilent Technologies XL-10, cat. no. 200315)
-
bioRxiv - Molecular Biology 2024Quote: ... The expression plasmids were transformed into Escherichia Coli strain BL21-Codonplus(DE3)-RIL (Stratagene). The expression and purification of each protein was performed as described previously.77 Briefly ...
-
bioRxiv - Biophysics 2022Quote: TRPV4 N-terminal constructs were expressed in Escherichia coli BL21-Gold(DE3) (Agilent Technologies) grown in terrific broth (TB ...
-
bioRxiv - Molecular Biology 2023Quote: ... coli cells after was taken for RFP analysis using fluorescence spectrophotometer (Cary Eclipse, Agilent) with excitation wavelength of 550 nm ...
-
bioRxiv - Biophysics 2023Quote: ... These histones were co-expressed in Escherichia coli strain BL21-codonplus-DE3-RIL (Agilent), and the histone octamer with the K120>C mutation in histone H2A was purified according to Ref33 ...
-
bioRxiv - Biophysics 2023Quote: ... Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Biochemistry 2024Quote: The codon-optimized plasmid for hPLIN1 was expressed in Escherichia coli ArcticExpress (DE3) (Agilent) while codon optimized plasmids hPLIN2 and hPLIN3 were expressed in E ...
-
bioRxiv - Molecular Biology 2024Quote: ... 150 ng of purified RNA was mixed with RNA standards (One Colour RNA Spike-In Kit; Agilent, Santa Clara, CA – 5188–5282) and the mixture labelled with LowInput QuickAmp Labeling Kit One-Color (Agilent 5190-2305) ...
-
bioRxiv - Cell Biology 2021Quote: ... The E-box mutant was constructed with QuikChange II XL Site-Directed Mutagenesis Kit (Agilent Technologies) using primers 5’-cgcgggttcccaccttgtggccagaagatcttctgggcagaactactcgtttggc-3’ and 5’-gccaaacgagtagttctgcccagaagatcttctggccacaaggtgggaacccgcg-3’ ...
-
bioRxiv - Microbiology 2022Quote: ... RTCA E-plate VIEW 16 plates with embedded golden electrodes (#300600880, Agilent, Santa Clara, CA, USA) were used for the experiments ...
-
bioRxiv - Cancer Biology 2023Quote: ... The tissues were stained using H&E or a primary antibody against Ki67 (GA626, Dako Omnis) and an HRP-labeled secondary antibody (Abcam) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 x 104 tumor cells were plated per well in a 96-well E-plate (Agilent), and impedance is read for 16 hours during incubation ...
-
bioRxiv - Cell Biology 2024Quote: ... 50 µl of the medium was applied into Matrigel-coated impedance plates (E-Plate 16, Agilent) for baseline recording ...
-
bioRxiv - Evolutionary Biology 2024Quote: The peak areas of each chromatogram were integrated with MSD ChemStation E.02.01.1177 (Agilent Technologies, USA) to obtain the total ion current signals ...
-
bioRxiv - Immunology 2021Quote: ... embedded in paraffin, and automatically stained for SARS-CoV-2 (2019-nCoV) Nucleocapsid (SINO BIO, #40143-R019) or for fibrin (DAKO, #A0080) through LEICA BOND RX 1h room- temperature (RT ...
-
bioRxiv - Molecular Biology 2022Quote: ... 3C library preparation and target enrichment using a custom-designed collection of 6979 biotinylated RNA “baits” targeting single MboI restriction fragments chr15:10283500-13195800 (mm9) (Suppl. Table S2; Agilent Technologies; as in Ref.3) were performed following the SureSelectXT Target Enrichment System for Illumina Paired-End Multiplexed Sequencing Library protocol ...
-
bioRxiv - Biochemistry 2021Quote: ... All AtAtm3 constructs were overexpressed in Escherichia coli BL21-gold (DE3) cells (Agilent Technologies, CA) using ZYM-5052 autoinduction media as described previously (Fan et al. ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: The nsp14 and nsp10 proteins were expressed in Escherichia coli BL21-CodonPlus(DE3)-RIL (Stratagene). The bacteria were grown in Luria–Bertani medium supplemented with 50 mg/mL kanamycin at 37 °C to an OD600 of 0.6 ...
-
bioRxiv - Biochemistry 2020Quote: ... coli cells by the heat-shock approach as described in the supplier’s manual (Novagen/Agilent) and by antibiotic selection using Zeocin (Invitrogen/ThermoFisher) ...
-
bioRxiv - Cell Biology 2019Quote: ... Proteins were expressed in BL21-CodonPlus (DE3)-RIL Escherichia coli (Agilent Technologies, catalog no. 230245) at 37°C with 0.25 mM IPTG (Isopropyl β-D-1-thiogalactopyranoside ...
-
bioRxiv - Microbiology 2021Quote: All transformations for cloning or plasmid amplification were performed in Escherichia coli XL10 Gold (Agilent) according to manufacturer’s instructions.
-
bioRxiv - Biophysics 2022Quote: ... Aβ40/Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Plant Biology 2023Quote: ... Substrate proteins were induced and expressed in Escherichia coli BL21 CodonPlus(DE3)-RIL cells (Stratagene) over night at 18°C after induction with 1 mM IPTG ...
-
bioRxiv - Neuroscience 2022Quote: ... The insert was verified by sequencing and then transformed into BL21 Escherichia coli strain (Stratagene) for expression ...
-
bioRxiv - Neuroscience 2023Quote: ... All other proteins were expressed in Escherichia coli BL21-CodonPlus(DE3)-RIL cells (Agilent Technologies) in LB medium at 16 □ overnight ...
-
bioRxiv - Immunology 2022Quote: ... b) c-KIT− (DAKO-MA512944) (Nagasawa et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... c) Representative electropherograms (Agilent’s Bioanalyzer) of cDNA and tagmented cDNA size distributions for both cell lines ...
-
bioRxiv - Genetics 2021Quote: ... The obtained chromatograms were analyzed with the software Enhanced Chemstation E.01.00.237 (Agilent, Santa Clara, CA, USA). Peak identification was carried out automatically with the initial area reject parameter set to 0 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: E-cigarette liquids were diluted 100X into spectral grade methanol and injected into the GCMS detector (Agilent 7890A gas chromatograph with 5975 MSD detector) ...
-
bioRxiv - Biochemistry 2020Quote: ... All E protein variants were obtained by site-directed mutagenesis using QuikChange kit (Stratagene, La Jolla, California) and were confirmed by sequencing the plasmid DNA at Macrogen Company (Seoul ...
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Immunology 2022Quote: ... Each sample slide was stained with H&E (Hematoxylin Dako #S3309, Eosin, Dako #CS701, bluing buffer #CS702) and the brightfield images were captured via Leica whole-slide scanner at 10X resolution.
-
bioRxiv - Plant Biology 2023Quote: ... mass calibrant using the “atune.u” autotune method provided with Agilent GC/MSD Productivity ChemStation Software (Revision E.02.01.1177; Agilent Technologies ...
-
bioRxiv - Microbiology 2021Quote: ... were designed based on the DNA sequence for SARS-CoV-2 Wuhan-Hu-1 using the QuickChange Primer Design tool (Agilent Technologies, Inc.). Mutagenesis was carried out on a pCDNA-SARs2 Wuhan-Hu 1 S plasmid to create the P681H mutation ...
-
bioRxiv - Immunology 2021Quote: QuikChange Lightening Site-Directed Mutagenesis kit was used to generate amino acid substitutions in the SARS-CoV-2 Wuhan Spike expression vector (Seow et al., 2020) or the D614G pCDNA Spike plasmid (S. A. Kemp et al., 2020) following the manufacturer’s instructions (Agilent Technologies, Inc., Santa Clara, CA). Spike B.1.1.7 was synthesised by Genewiz ...
-
bioRxiv - Biophysics 2021Quote: ... A reverse phase C-18 column (4.6 x 150 mm, Agilent Eclipse XDB- C-18) was used to separate the reaction mixture containing nucleotides by an HPLC using buffer A (100 mM KH2PO4 ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
Mechanical forces impair antigen discrimination by reducing differences in T cell receptor off-ratesbioRxiv - Immunology 2022Quote: ... TCR α and β chains were expressed in BL21 (DE3)-RIPL Escherichia coli cells (Agilent Technologies) following induction with 0.15 mM IPTG ...
-
bioRxiv - Biophysics 2019Quote: ... Escherichia coli XL10-Gold and BL21(DE3) Gold cells were purchased from STRATAGENE (San Diego, CA). 6-Acryloyl-2-Dimethylaminonaphthalene (Acrylodan) ...
-
bioRxiv - Biophysics 2020Quote: ... were prepared by expression in Escherichia coli BL21 (DE3) Gold Strain (Agilent Technologies, Santa Clara, USA)46 ...
-
bioRxiv - Neuroscience 2020Quote: ... All recombinant proteins were expressed in the BL21-Gold (DE3) pLysS strain of Escherichia coli (Agilent) in pGEX-KG vectors as glutathione S-transferase (GST ...
-
bioRxiv - Biochemistry 2022Quote: ... coli LacI DBD (1121 variants in total) were synthesized as single-stranded oligonucleotide pools (Agilent Technologies). Extant DBDs exceeding 60aa long were truncated from the N-terminus to 60 residues in length to comply with DNA synthesis restrictions ...
-
bioRxiv - Biochemistry 2023Quote: ... SUV420H1 plasmid was transformed into Escherichia coli BL2-codon plus (DE3)-RIL competent cells (Agilent technologies) and grown in 2xYT-Kan media ...
-
bioRxiv - Cell Biology 2023Quote: ... and the expression vector was introduced into an Escherichia coli strain BL21-CodonPlus (DE3)-RIL (Agilent). The transformed bacterial cells were grown at 37°C until OD600 reached 0.7 ...
-
Sex Differences in Brain Tumor Glutamine Metabolism Reveal Sex-Specific Vulnerabilities to TreatmentbioRxiv - Cancer Biology 2021Quote: Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...