Labshake search
Citations for Atlas Antibodies AB :
1 - 50 of 367 citations for Aprataxin And PNKP Like Factor APLF Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2024Quote: ... NUDT16L1 antibody (Atlas Antibodies) and CRM1 antibody (Santa Cruz ...
-
Spatial visualization of A-to-I Editing in cells using Endonuclease V Immunostaining Assay (EndoVIA)bioRxiv - Molecular Biology 2024Quote: ... or anti-ADAR1 antibody (Atlas Antibodies) in blocking buffer and incubated for 1 hour ...
-
bioRxiv - Cancer Biology 2021Quote: ... or anti-ALDH1A3-antibody (Atlas Antibodies, HPA046271) on the Ventana BenchMark (Roche ...
-
bioRxiv - Cell Biology 2019Quote: Primary antibodies: Sept2 (SIGMA Atlas Antibodies HPA018481), GFP (Roche 12600500) ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Desmocollin-1 antibody (HPA012891, ATLAS ANTIBODIES). The secondary antibodies used were as follows ...
-
bioRxiv - Cell Biology 2023Quote: Primary antibodies used were SNX17 rabbit polyclonal antibody (pAb) (1:200, HPA043867, Atlas Antibodies), SNX17 mouse monoclonal antibody (mAb ...
-
bioRxiv - Cancer Biology 2022Quote: ... Antibodies for ALKBH5 (HPA007196, Atlas Antibodies, Stockholm, Sweden) and FTO (Ab124892 ...
-
bioRxiv - Microbiology 2021Quote: ... subsequent rabbit anti ACE2 antibody (HPA000288, Atlas Antibodies) and HRP conjugated anti rabbit IgG (7074S ...
-
bioRxiv - Immunology 2020Quote: ... Primary antibodies (rabbit anti-ASNS – HPA029318, Atlas Antibodies, mouse anti-β actin ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 was purchased from Atlas Antibodies. Antibody against p16 was purchased from Proteintech.
-
bioRxiv - Molecular Biology 2022Quote: ... anti-EXO5 antibody (0.4 μg/mL, Atlas Antibodies), and/or anti-alpha-tubulin antibody (1:000 μg/mL ...
-
bioRxiv - Cell Biology 2023Quote: ... Anti-HAUS tubulin antibodies (HAUS1 - HPA040652, Atlas antibodies, x500 dilution ...
-
bioRxiv - Molecular Biology 2023Quote: ... and a commercial antibody against the wild-type protein was used as the primary detection antibody (Anti-CTB-50L17.10 antibody produced in rabbit; Prestige Antibodies® Powered by Atlas Antibodies). A species-specific sulfo-tagged antibody (Anti Rabbit Antibody Goat SULFO-TAG Labeled ...
-
bioRxiv - Immunology 2019Quote: Primary antibody: polyclonal human PON1 from rabbit (Atlas Antibodies).
-
bioRxiv - Cell Biology 2019Quote: ... Primary antibodies were diluted as follows: TPR (Atlas antibodies) 1/50 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 (HPA001591) was purchased from Atlas Antibodies. Antibody against SRPK1 (611072 ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit polyclonal anti-MCT8 antibody 1:400 (Atlas antibodies), rabbit polyclonal anti-D3 antibody (Novus Biologicals) ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-METTL14 rabbit antibody (1:300, HPA038002; Atlas Antibodies), anti-α-Tubulin mouse antibody (1:1000 ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-VAPB polyclonal antibody (Atlas antibody HPA 013144), mouse anti-VAPA monoclonal antibody (Sigma 10355-4C12 ...
-
bioRxiv - Immunology 2024Quote: ... rabbit polyclonal LRBA antibody (#HPA023567, Atlas Antibodies, 1:1000), mouse AP1 100/3 hybridoma antibody (home-made) ...
-
bioRxiv - Neuroscience 2022Quote: ... The primary antibodies used were: rabbit anti-Barhl1 polyclonal antibody (Atlas Antibodies, HPA004809, Sigma, 1:500), goat anti-Robo3 polyclonal antibody (R&D Systems ...
-
bioRxiv - Cancer Biology 2022Quote: ... Primary antibodies for ALKBH5 (1:1000 dilution, HPA007196; Atlas Antibodies), FTO (1:1000 dilution ...
-
bioRxiv - Cancer Biology 2019Quote: Rabbit polyclonal anti-HN1 antibody was purchased from Atlas Antibodies (Sigma-Aldrich - HPA059729 ...
-
bioRxiv - Microbiology 2021Quote: Primary antibody: polyclonal human PON1 from rabbit (HPA001610, Atlas Antibodies). Secondary antibody ...
-
bioRxiv - Cell Biology 2021Quote: ... and probed with antibodies to hC9ORF78 (Atlas antibodies and Bethyl), α-tubulin (Sigma) ...
-
bioRxiv - Microbiology 2021Quote: ... anti-PAPD5 antibody (Atlas Antibodies cat. no. HPA042968, Bromma, Sweden), and anti-beta Actin antibody (Abcam cat ...
-
bioRxiv - Genetics 2022Quote: ... polyclonal rabbit primary antibodies reactive against POU3F3 (Atlas Antibodies, HPA067151) were applied to the tissue sections at 0.5 µg/ml overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... The rabbit anti-OTUD4 antibody (Atlas Antibodies HPA036623, 1:200) was used ...
-
bioRxiv - Genetics 2023Quote: ... incubated with primary anti-Pcyt2 antibody (HPA023033, Atlas Antibodies, Sweden) Followed by and a HRP-labelled secondary Anti-rabbit antibody (#7074 ...
-
bioRxiv - Cell Biology 2023Quote: ... polyclonal rabbit antibody to IRSp53 (BAIAP2) from Atlas Antibodies (HPA023310), HRP-conjugated beta actin monoclonal antibody from Proteintech (HRP-60008) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Primary antibodies used in this study are ALKBH5 (Atlas Antibodies), β Actin (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Cux2 (Atlas Antibodies, Stockholm ...
-
bioRxiv - Cell Biology 2022Quote: ... Ctsb (Atlas Antibodies, Sigma Aldrich HPA018156 ...
-
bioRxiv - Cancer Biology 2023Quote: ... HPA000962 (Atlas Antibodies); rabbit anti-ASPH ...
-
bioRxiv - Microbiology 2023Quote: ... The following primary antibodies were used: anti-LSM14A rabbit polyclonal antibody (1: 500; HPA017961, Atlas Antibodies, Stockholm, Sweden), anti-p24 mouse monoclonal antibody (1 ...
-
bioRxiv - Molecular Biology 2019Quote: ... rabbit anti-Nup205 antibody (1:500, HPA024574, Lot-R11937, ATLAS antibodies) and rabbit anti-CTCF antibody (1:500 ...
-
bioRxiv - Biochemistry 2021Quote: the following antibodies were used: rabbit anti-SHMT1 (HPA0233314, Atlas antibodies); mouse anti-DHFR (WH0001719M1 ...
-
bioRxiv - Cancer Biology 2020Quote: ... Specific antibodies against ATR 1:1000 (Atlas antibodies Cat no. HPA054320) and ATR S428 1:2000 (cell signalling Cat no ...
-
bioRxiv - Neuroscience 2021Quote: ... The primary antibodies used were rabbit anti-EMX2 (HPA065294, Atlas Antibodies) and normal rabbit IgG (#2729 ...
-
bioRxiv - Molecular Biology 2022Quote: ... PAF1 primary antibody was diluted at 1:500 (Atlas antibodies, HPA043637). AlexaFluor555 and Hoechst33342 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Antibodies used were anti-RBPMS (Atlas antibodies HPA056999, 1:1000 dil), anti-RBFOX2 (Atlas antibodies HPA006240 – 1:500 dil) ...
-
bioRxiv - Cell Biology 2023Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2023Quote: ... GLDC protein abundance was determined using anti-GLDC antibody (Atlas antibodies), with GAPDH (detected using anti-GAPDH ...
-
bioRxiv - Microbiology 2024Quote: ... and immunostained with our anti-EBOV VP35 mouse antibody and an anti-STRAP rabbit antibody (Atlas Antibodies, Bromma, Sweden) at 1:3000 and 1:1000 respectively for several hours at 37°C ...
-
bioRxiv - Cancer Biology 2022Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
-
bioRxiv - Cell Biology 2021Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
-
bioRxiv - Cancer Biology 2020Quote: ... and incubated in the anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) overnight at 4℃ ...
-
bioRxiv - Cancer Biology 2020Quote: ... After being incubated with anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) and following secondary antibody according to product manual ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.