Labshake search
Citations for Invivogen :
1 - 50 of 387 citations for Synthetic Apoptosis Regulator Bcl 2 BCL2 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2024Quote: ... and 20 µM) and 2’3’-cGAMP (positive regulator of ISRE; InvivoGen, cat: tlrl-nacga23s) in 1mL complete RPMI medium for 24h ...
-
bioRxiv - Immunology 2023Quote: Synthetic MPLA was purchased from InvivoGen, USA ...
-
bioRxiv - Cell Biology 2024Quote: Synthetic dsRNA analogue poly(I:C) HMW (Invivogen) was transfected into U2OS cells using JetPRIME transfection reagent (Roche Applied Science ...
-
bioRxiv - Immunology 2023Quote: ... cells were incubated for 2 hours with or without TLR2 blocking antibody (Invivogen cat.# mab2-mtlr2) followed by incubation with CEP or Pam3CSK4 (Invivogen cat.# tlrl-pms ...
-
bioRxiv - Immunology 2020Quote: Synthetic LL-37 (Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) was purchased from Invivogen (USA). Lyophilized peptide was reconstituted with endotoxin-free water to reach a final concentration of 1 mg/ml ...
-
bioRxiv - Immunology 2023Quote: ... 50 µg synthetic Class B CpG oligonucleotide (ODN1826) (vac-1826; Invivogen), or unadjuvanted ...
-
bioRxiv - Microbiology 2021Quote: Human IgA was purified from fecal supernatants with Peptide M/ Agarose (InvivoGen, Cat. No. gel-pdm-2) as described by the manufacturer ...
-
bioRxiv - Systems Biology 2020Quote: ... and simulated with dose titrations of the synthetic STING agonist DMXAA (Invivogen) for 1.5h ...
-
bioRxiv - Immunology 2021Quote: ... TRIF inhibitory peptide (InvivoGen) at 25 μM ...
-
bioRxiv - Immunology 2020Quote: ... TRIF inhibitory peptide (InvivoGen) at 25 μM ...
-
bioRxiv - Immunology 2022Quote: OVA323-339 peptide (Invivogen) before analysis.
-
bioRxiv - Immunology 2021Quote: ... and 5μM OVAII peptide (InvivoGen). IL-2 (10ng/mL) ...
-
bioRxiv - Immunology 2021Quote: ... MHCI-specific ovalbumin SIINFEKL/OVA257-264 or MHCII-specific ovalbumin peptide OVA323-339 were added at 2 μg/ml (Invivogen). Phorbol 12-myristate 13-acetate (Promega ...
-
bioRxiv - Immunology 2022Quote: ... peptide M-coupled agarose beads (Invivogen) and Ni Sepharose® Excel Resin (GE Healthcare) ...
-
bioRxiv - Immunology 2022Quote: ... β-glucan-peptide was from Invivogen and dissolved at 5 mg/ml in sterile PBS ...
-
bioRxiv - Cancer Biology 2023Quote: ... OVA peptide (a.a.257-264, InvivoGen) was added at concentration of 5 μg/ml to washed pooled cells and cultured as 5 x 106 cells/ml ...
-
bioRxiv - Microbiology 2020Quote: ... anti-TLR2 blocking antibodies (10μg/ml, Invivogen), or corresponding isotype controls (10μg/ml ...
-
bioRxiv - Microbiology 2023Quote: ... Cell viability was analysed using the Dead Cell Apoptosis Kit for Flow Cytometry from Invivogen (#V13242), with early apoptotic cells scoring Annexin V-positive and late apoptotic cells scoring Annexin V- and propidium iodide (PI)-positive ...
-
bioRxiv - Immunology 2019Quote: ... 1 μg/ml synthetic (B) form DNA analog poly(deoxyadenylic-deoxythymidylic) acid (poly(dA:dT)) (Invivogen) or 400 nM dsDNA containing GATC or Gm6ATC sequences ...
-
bioRxiv - Molecular Biology 2023Quote: ... DF-1 chicken fibroblasts were stimulated with the synthetic TLR2/6 antagonist Pam2CSK4 (InvivoGen tlrl-pms) at a final concentration of 10 µg/ml for the indicated times prior to lysis or fixation ...
-
bioRxiv - Immunology 2020Quote: ... B-glucan peptide (BGP) 100ug/mL (Invivogen), high mobility group box 1 (HMGB1 ...
-
bioRxiv - Immunology 2022Quote: ... and peptide M-coupled agarose beads (Invivogen), respectively ...
-
bioRxiv - Immunology 2020Quote: ... along with OVA peptide 323-339 (Invivogen) for antigen specific activation ...
-
bioRxiv - Immunology 2022Quote: ... normal rat PAb IgG control blocking antibodies (InvivoGen), Dexamethasone (10µM ...
-
bioRxiv - Immunology 2020Quote: ... The coding sequences of the 4A3 heavy chain variable region and light chain variable region were amplified by adding the IL-2 signal peptide and cloned into the expression vectors pFUSE-CHIg-HG1 and pFUSE2-CLIg-hk (Invivogen, San Diego, CA), respectively ...
-
bioRxiv - Microbiology 2020Quote: ... thuringiensis-infected mice was intravitreally treated with the synthetic TLR2/4 inhibitor OxPAPC (Invivogen; 30 ng/μl) (WT+OxPAPC ...
-
bioRxiv - Microbiology 2020Quote: ... and Peptide M / Agarose (InvivoGen, San Diego, CA), respectively ...
-
bioRxiv - Immunology 2023Quote: ... total IgA purified on Peptide M-agarose (Invivogen) was incubated with M-280 Streptavidin Dynabeads coated with 10 µg biotinylated TG2 or TG3 ...
-
bioRxiv - Cell Biology 2022Quote: ... β-glucan peptide (Invivogen, tlrl-bn, ant-zn-05), Hygromycin B (Invivogen ...
-
bioRxiv - Pathology 2020Quote: ... a truncated HSP27 peptide consisting of the C-terminal half of the peptide, (100 µg, 75 µL) mixed with an aluminum hydroxide gel adjuvant (Alhydrogel® 2%, Al, 25 µL; Invivogen vac-alu-250, San Diego, CA). One week after the commencement of E2 and/or vaccinations ...
-
bioRxiv - Immunology 2020Quote: ... clarified by centrifugation and subsequently incubated with Peptide M(Invivogen)/Protein G-coupled sepharose beads (Invivogen ...
-
bioRxiv - Immunology 2023Quote: ... variable regions and leader peptides were cloned into pVITRO1 (Invivogen) plasmids that contained the constant regions for mouse IgG1 κ heavy and light chains using Gibson Assembly75 ...
-
bioRxiv - Physiology 2021Quote: ... transfection: Cells with 60-80% confluency were transfected with synthetic double-stranded RNA poly(I:C) (high molecular weight, InvivoGen #tlrl-pic) using lipofectamine 2000 following the manufacture’s protocol ...
-
bioRxiv - Immunology 2022Quote: ... OT-I splenocytes were treated with 10μg/ml SIINFEKL peptide (Invivogen) for 16h ...
-
bioRxiv - Cancer Biology 2023Quote: ... or with 5 ug/ml OVA peptide (a.a.257-264, InvivoGen) for 4-5 hr in the presence of Golgi Stop (1/1000 ...
-
bioRxiv - Cell Biology 2020Quote: ... OT-II peptide OVA323-339 (ISQAVHAAHAEINEAGR) was from InvivoGen (San Diego, CA) and kindly provided by Paula Oliver (Children’s Hospital of Philadelphia ...
-
bioRxiv - Bioengineering 2020Quote: ... OVA 257-264 (SIINFEKL peptides) was purchased from InvivoGen (San Diego, CA, USA). Amine-terminated GGGGRGDSP (G4RGDSP ...
-
bioRxiv - Immunology 2019Quote: ... TRIF peptide inhibitor was used at a final concentration of 25 μM (Invivogen). Actinomycin D (Sigma ...
-
bioRxiv - Immunology 2022Quote: ... Sorted tumor APC populations were pulsed with 0.01 ng/mL SIINFEKL peptide (Invivogen) at 37°C for 1.25 hours and then washed twice.
-
bioRxiv - Microbiology 2022Quote: ... 20 µl of 10 µg/ml β-glucan peptides (Invivogen; catalog #tlrl-bgp), 20 µl of β-glucan peptides + Piceatannol (250nM ...
-
The T-cell niche tunes immune function through modulation of the cytoskeleton and TCR-antigen forcesbioRxiv - Bioengineering 2024Quote: ... Blinatumomab (# bimab-hcd19cd3) and SIINFEKL-OVA peptide (# vac-sin) were purchased from InVivoGen. Cupric Sulfate ...
-
bioRxiv - Bioengineering 2020Quote: ... cells were incubated with 10 nM chicken egg ovalbumin peptide 257-264 (SIINFEKL, Invivogen) with or without 1000 IU/mL IL-2 (or equimolar amounts modified protein ...
-
bioRxiv - Immunology 2020Quote: SIINFEKL peptide (VACSIN) and CpG(tlr-1826-1) were from InvivoGen (San Diego, CA). Neoantigen peptides were purchased from LifeTein (Somerset ...
-
bioRxiv - Immunology 2024Quote: ... or by using ovalbumin peptide (OVA257-264, InvivoGen, San Diego, CA, USA; 1 μg/ml), which was loaded on DCs (used at a 3:1 T-to-DC ratio) ...
-
bioRxiv - Immunology 2022Quote: ... 2 ug/mL Pam3CSK4 (TLR1/2 agonist, Invivogen), and 1 ug/mL FSL-1 (TLR2/6 agonist ...
-
bioRxiv - Bioengineering 2021Quote: ... and 2 µl/ml primicin (Ant-pm-2, InvivoGen) at 37°C for 19 hours.
-
bioRxiv - Bioengineering 2022Quote: ... and 2 μl/ml primocin (Ant-pm-2, InvivoGen) at 37°C for 19 hours ...
-
bioRxiv - Immunology 2022Quote: ... total IgA was purified from saliva using Peptide M/agarose (InvivoGen Inc., San Diego, CA, USA) and used for the neutralization at low-dilution (1:2-1:10) ...
-
bioRxiv - Immunology 2021Quote: ... these were co-cultured 1:1 in complete RPMI containing OVA peptide (5 mg/mL, InvivoGen) and recombinant TGFβ (1 ng/mL ...
-
bioRxiv - Immunology 2023Quote: ... Serum flow-through was then passed through 1 mL of Peptide M agarose (InvivoGen, gel-pdm-5) affinity column in gravity mode ...