Labshake search
Citations for Thermo Fisher :
1 - 50 of 10000+ citations for Trans Dcca 100 Ug Ml In Acetonitrile D3 1 Carboxyl 13C2 99%;1 D 97% 97% Chemical Purity since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2021Quote: ... mouse anti-Golgin-97 (1:100, Invitrogen, A-21270), rat anti-Lamp1 (1:20 ...
-
bioRxiv - Cell Biology 2022Quote: ... Golgin-97 (CDF4, #A-21270, Thermo Fisher Scientific; IF 1:100); rabbit polyclonal antibodies to Rab4 (#ab13252 ...
-
Rac1, Rac3 GTPases and TPC2 are required for axonal outgrowth and migration of cortical interneuronsbioRxiv - Neuroscience 2022Quote: ... mouse monoclonal anti-Golgin-97 (1:100; Thermo Fisher Scientific, MA USA), mouse monoclonal anti-Lamp-1 (1:50 ...
-
bioRxiv - Molecular Biology 2022Quote: ... and 1 mM 3’-d-GTP [>99% purity for UTP and CTP (ThermoFisher); ≥95% purity for 3’-dGTP (Jena Bioscience)] and incubated 2 min at 37°C (to “chase,” and thereby to stabilize ...
-
bioRxiv - Cell Biology 2019Quote: ... 1:300 Mouse anti-Golgin-97 (Invitrogen, Carlsbad, CA), 1:500 Goat anti-VPS35 (Abcam ...
-
bioRxiv - Neuroscience 2022Quote: ... 100 U ml-1 penicillin/streptomycin and 100 ug ml-1 G418 (Gibco), as previously described (12).
-
bioRxiv - Neuroscience 2019Quote: ... mouse anti-Golgin 97 (ThermoFisher), 1μg/ml ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2022Quote: ... Golgin 97 (mouse monoclonal; Molecular Probes), GM130 (mouse monoclonal ...
-
bioRxiv - Neuroscience 2022Quote: ... Complete hNSC serum free media (100 ml) comprised 97 mL Knockout DMEM/F-12 (Gibco®, 12660-012), 1 mL GlutaMAX™ (Gibco® ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 1% penicillin (100 U/ml) and streptomycin (100 ug/ml) or puromycin (10 ug/ml) (Thermo Fisher, A11138-03). All isolates except Omicron were propagated and titered in Vero EG cells and using penicillin and streptomycin ...
-
bioRxiv - Systems Biology 2023Quote: ... A 1 mL aliquot of 2:2:1 (v/v) mixture of ≥ 99.9% purity acetonitrile (Fisher Scientific; Cat.A998-4) ≥ 99.8% purity methanol (Fisher Scientific ...
-
bioRxiv - Cell Biology 2020Quote: ... Golgin-97 (CDF4, Invitrogen, cat.# A-21270), GM130 (35/GM130 ...
-
bioRxiv - Cell Biology 2020Quote: ... Golgi-97 (clone CDF4, ThermoFisher A-21270), Clathrin Heavy chain (clone X22 ...
-
bioRxiv - Cancer Biology 2019Quote: ... 97-mer oligonucleotides were purchased from Invitrogen and PCR amplified using the primers miRE-Xho-fw (5’ TGAACTCGAGAAGGTATATTGCTGTTGACAGTGAGCG-3’ ...
-
bioRxiv - Cancer Biology 2022Quote: ... 100 U/mL penicillin 100 ug/mL streptomycin (1% Pen/Strep; Gibco, #15140-122), and 1 mM sodium pyruvate (Gibco ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Triethylamine and 5-hehyn-1-ol 97% were purchased from Acros Organics (Geel, Belgium). Deuterium oxide (D2O ...
-
bioRxiv - Bioengineering 2022Quote: ... isopropyl β-D-1- thiogalactopyranoside (IPTG) (99%; Fisher Scientific), thiol-PEG-acid (HOOC-PEG-SH ...
-
bioRxiv - Bioengineering 2022Quote: ... 1 ug/mL laminin (Invitrogen), 1 mM cAMP (Tocris ...
-
bioRxiv - Systems Biology 2021Quote: ... and incubated with 1:100 dilution of streptavidin-594 (1 ug/ml; ThermoFisher, S32356) solution ...
-
bioRxiv - Molecular Biology 2021Quote: Chemical competent BL21(D3) cells (Invitrogen) were transformed with selected pPE2-Fab plasmids and grown on LBagar/Kanamycin/1% glucose plates ...
-
bioRxiv - Animal Behavior and Cognition 2023Quote: ... 500 μL n-Hexane (97+ %; Acros Organics, Geel, Belgium) was added to trunk samples to remove the interference of precipitated lipids ...
-
bioRxiv - Biochemistry 2023Quote: ... Golgin 97 (clone CDF4, mouse monoclonal, Thermo Scientific Fisher). The antibody against cathepsin D (CTSD ...
-
bioRxiv - Cancer Biology 2024Quote: ... 99+% (Thermo Scientific Chemicals). Immediately following stimulation ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting immobilized complexes were supplemented with 1 μl 0 or 1 mM ATP (>99% purity; ThermoFisher) in transcription buffer and incubated 5 min at 37°C (to enable termination) ...
-
bioRxiv - Biophysics 2022Quote: ... 0.020 M potassium phosphate monobasic), sodium chloride (BioXtra grade, purity ≥99.5%) and D-(-)-Fructose (HPLC grade, purity ≥99%) from Thermo Fisher Scientific (Waltham ...
-
bioRxiv - Cancer Biology 2021Quote: ... and 1 ug/ml DAPI (Invitrogen), and mounted onto slides using Prolong Gold Antifade reagent (Invitrogen) ...
-
bioRxiv - Neuroscience 2020Quote: ... 100 ug/ml streptomycin (ThermoFisher) and 0.1 mg/ml colchicine (Sigma) ...
-
bioRxiv - Bioengineering 2020Quote: ... 100 ug/ml Streptomycin (Gibco) and 5 ng/ml basic Fibroblast Growth Factor (FGFb ...
-
bioRxiv - Immunology 2021Quote: ... 100 ug/ml Streptomycin (Invitrogen) and 10% FBS (R&D Systems) ...
-
bioRxiv - Bioengineering 2022Quote: ... 100 ug/mL Streptomycin (Gibco), 100 IU/mL recombinant human IL-2 (Proleukin ...
-
bioRxiv - Immunology 2023Quote: ... 100 ug/mL streptomycin (Gibco). Either 5U IL-2 (Peprotech ...
-
bioRxiv - Cancer Biology 2023Quote: ... 100 ug/mL streptomycin (Gibco) and 0.292 mg/mL glutamine (Gibco) ...
-
bioRxiv - Cell Biology 2023Quote: ... Nuclei were prepared from the cells were incubated in DNA staining solution (PBS; 1% Bovine Serum Albumin; 50 ug/ml Propidium iodide P4170-25mg Sigma-Aldrich; 100 ug/ml RNAse A 12091039 Invitrogen) on ice for at least one hour before sorting ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting reaction mixtures then were supplemented with 1 μl 0 or 1 mM ATP (>99% purity; ThermoFisher) in transcription buffer and incubated 5 min at 37°C (to enable termination) ...
-
bioRxiv - Neuroscience 2022Quote: ... prepared according to manufacturer’s specifications with 97 mL of Neurobasal® Medium (Gibco®, 21103), 2 mL of B-27® Serum-Free Supplement (Gibco® ...
-
bioRxiv - Biochemistry 2023Quote: ... normal polypropylene (PP) vials (CAT# C5000-97, Thermo Fisher Scientific), or hydrophilic vials (ProteoSave vial ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... HY-100937)30 or the MTNR1A antagonist luzindole (97%, ThermoFisher, J61915-#0).31 We used the EC80 of NECA (0.05 µM ...
-
bioRxiv - Biochemistry 2019Quote: ... the supernatant (approximately 97 μL) was removed and the pellet resuspended using 1 mM β-mercaptoethanol (Fisher Scientific) in 1x TG-SDS buffer (Bio Basic Inc ...
-
bioRxiv - Cell Biology 2023Quote: ... DAPI staining (Life Technologies, 1 ug/ml) was performed for ten minutes followed by two additional five-minute 1X PBS washes ...
-
bioRxiv - Genomics 2023Quote: ... 1 ug/mL concentration of puromycin (GIBCO/Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2023Quote: ... DAPI staining (Life Technologies, 1 ug/ml) was performed for ten minutes followed by two additional three-minute 1X PBS rinses ...
-
bioRxiv - Bioengineering 2023Quote: ... 1 ug/ml Nile Red (Invitrogen, N1142) was added into the culture medium 1 h before imaging and was present during imaging.
-
bioRxiv - Genomics 2021Quote: ... 100 ug/mL streptomycin (Gibco, 15140122), and freshly-added 1uM insulin (Sigma-Aldrich I6634) ...
-
bioRxiv - Cancer Biology 2021Quote: ... and 100 ug/mL Streptomycin (Gibco). K562 (ATCC ...
-
bioRxiv - Genomics 2022Quote: ... and 100 ug/mL streptomycin (Gibco). HEK293T cells were grown in Dulbecco’s modified eagle medium (DMEM ...
-
bioRxiv - Biochemistry 2023Quote: ... and 100 ug/mL Primocin (Invitrogen). Quiescent cells were gradually adapted to this media over a period of 4 days ...
-
bioRxiv - Neuroscience 2024Quote: ... PenStrep (Thermo Fisher; 100 ug/mL), and ascorbic acid (Millipore ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 100 ug/ml streptomycin (Invitrogen), placed underneath each insert ...
-
bioRxiv - Neuroscience 2023Quote: ... CTxB (ThermoFisher C34778, 100 ug/ml) was then applied 1:200 into each plate and allowed to incubate for >30 min before imaging ...