Labshake search
Citations for Thermo Fisher :
1 - 50 of 1635 citations for Benzo Ghi Perylene D12 98% 97% Chemical Purity since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: 2-Heptanone (purity > 98%) was purchased from ACROS Organics. Ringer’s solution (140 mM NaCl ...
-
bioRxiv - Cancer Biology 2023Quote: ... Indole-3-carbinol (97%) and β-Naphthoflavone (98+%) were obtained from Thermo Scientific™ (122190250 and A18543.06 ...
-
bioRxiv - Biochemistry 2021Quote: The 17-mer peptide SDEVTVETTSVFRADFL was produced with a purity >98% by Thermo Fisher Scientific.
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Microbiology 2023Quote: ... and with absolute ethanol (200 proof; purity ≥ 99.5%; Thermo Scientific Chemicals) before every extraction and in between extraction steps.
-
bioRxiv - Cancer Biology 2020Quote: ... a 77 amino acid length peptide with >98% purity as determined by analytical HPLC was synthesized by Thermo Fisher Scientific (Waltham ...
-
bioRxiv - Neuroscience 2022Quote: ... were further confirmed by matching the retention times and mass spectra with authentic analogues (all purity >98%; ACROS Organics). For a particular compound ...
-
bioRxiv - Biochemistry 2021Quote: ... Norharmane 98% (Nor) (Acros Organics), 1,5-Diaminonaphthalene 97% (DAN ...
-
bioRxiv - Bioengineering 2022Quote: ... Fisher Scientific):DI water:triisopropylsilane (98%, Fisher Scientific):1,2-ethanedithiol (>98% ...
-
bioRxiv - Physiology 2019Quote: ... Quantity and chemical purity of RNA and cDNA were assessed using Nanodrop 2000 spectrophotometer (Thermo Fisher Scientific). mRNA expression was measured using real time polymerase chain reaction (RT-PCR ...
-
bioRxiv - Neuroscience 2019Quote: ... mouse anti-Golgin 97 (ThermoFisher), 1μg/ml ...
-
bioRxiv - Bioengineering 2022Quote: ... sodium borohydride (NaBH4, 98%, Fisher Scientific), trisodium citrate dihydrate (99.9% ...
-
bioRxiv - Genetics 2023Quote: ... 98 ng/µL DNA ladder (Invitrogen), and tdTomato CRISPR mix ...
-
bioRxiv - Molecular Biology 2024Quote: ... L-NAME (98%, Fisher Scientific: AAH6366606) was provided in the drinking water at 60mg/dL for 14 days ...
-
bioRxiv - Biochemistry 2022Quote: ... Golgin 97 (mouse monoclonal; Molecular Probes), GM130 (mouse monoclonal ...
-
bioRxiv - Cell Biology 2020Quote: ... Golgin-97 (CDF4, Invitrogen, cat.# A-21270), GM130 (35/GM130 ...
-
bioRxiv - Cell Biology 2020Quote: ... Golgi-97 (clone CDF4, ThermoFisher A-21270), Clathrin Heavy chain (clone X22 ...
-
bioRxiv - Cancer Biology 2019Quote: ... 97-mer oligonucleotides were purchased from Invitrogen and PCR amplified using the primers miRE-Xho-fw (5’ TGAACTCGAGAAGGTATATTGCTGTTGACAGTGAGCG-3’ ...
-
bioRxiv - Microbiology 2021Quote: ... 98 U/mL or RNase1 (Thermo Scientific, EN0601) 0.06 U/mL when required ...
-
bioRxiv - Microbiology 2022Quote: 8-Hydroxyquinoline-2-carboxylic acid (98%, ACROS Organics) was dissolved in distilled water with pH adjusted to 10 using a solution of 1 M sodium hydroxide for better solubility ...
-
bioRxiv - Bioengineering 2023Quote: ... and ergosterol (98%; Acros Organics-Thermo Fisher Scientific) (420 g L-1 Tween and 10 g L-1 ergosterol ...
-
bioRxiv - Bioengineering 2023Quote: ... and ergosterol (98%; Acros Organics-Thermo Fisher Scientific) (420 g L-1 Tween and 10 g L-1 ergosterol ...
-
bioRxiv - Biochemistry 2022Quote: ... 2 μg of total RNA harvested from parental RPE-1 and D12 cells utilizing the TRIzol reagent (ThermoFisher Scientific, 15596026) was used for cDNA synthesis (Applied Biosystems ...
-
bioRxiv - Cell Biology 2019Quote: ... 1:300 Mouse anti-Golgin-97 (Invitrogen, Carlsbad, CA), 1:500 Goat anti-VPS35 (Abcam ...
-
bioRxiv - Cell Biology 2021Quote: ... mouse anti-Golgin-97 (1:100, Invitrogen, A-21270), rat anti-Lamp1 (1:20 ...
-
bioRxiv - Animal Behavior and Cognition 2023Quote: ... 500 μL n-Hexane (97+ %; Acros Organics, Geel, Belgium) was added to trunk samples to remove the interference of precipitated lipids ...
-
bioRxiv - Biochemistry 2023Quote: ... Golgin 97 (clone CDF4, mouse monoclonal, Thermo Scientific Fisher). The antibody against cathepsin D (CTSD ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... 2 μg mL−1 puromycin (58-58-2, ≥98%, Invitrogen) and 100 μg mL−1 hygromycin (31282-04-9 ...
-
bioRxiv - Biochemistry 2023Quote: ... normal polypropylene (PP) vials (CAT# C5000-97, Thermo Fisher Scientific), or hydrophilic vials (ProteoSave vial ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... HY-100937)30 or the MTNR1A antagonist luzindole (97%, ThermoFisher, J61915-#0).31 We used the EC80 of NECA (0.05 µM ...
-
bioRxiv - Genomics 2020Quote: ... Purity was checked with NanoDrop (ThermoFisher) and concentration was checked with Qubit (ThermoFisher).
-
bioRxiv - Microbiology 2019Quote: ... purity on the NanoDrop (ThermoFisher Scientific) and concentration on the Qubit (dsDNA BR kit ...
-
bioRxiv - Bioengineering 2021Quote: ... purity examined by nanodrop (Thermo Fisher), quantify examined by Qubit (Thermo Fisher) ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... purity was assessed by Nanodrop (ThermoFisher), concentration was determined by Qubit (ThermoFisher) ...
-
bioRxiv - Genomics 2023Quote: ... purity with Nanodrop One (Fisher Scientific), and MW and integrity with pulsed field electrophoresis (CHEF Mapper ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... analyzed for purity with Nanodrop (ThermoFisher), analyzed for HMW integrity with 0.5% agarose gel electrophoresis ...
-
bioRxiv - Biochemistry 2021Quote: ... 1 mM Phenylmethylsulfonyl fluoride (PMSF; ACROS Organics, Cas#329-98-6), 5 mM β-ME ...
-
bioRxiv - Bioengineering 2020Quote: ... fusidic acid (FA; 98%, Acros Organics or F0756-#SLBN8134V, Sigma-Aldrich) was incorporated in the organic phase as previously described(52) ...
-
bioRxiv - Systems Biology 2021Quote: ... cell concentration and viability (98 %) was determined using Countess II (Invitrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2023Quote: ... 23% (w/w) fusidic acid (FA; 98%, 5552333, Thermo Scientific Acros) in PLA was incorporated (FA/PLA total content of 10% w/v ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... and 100 μg mL−1 hygromycin (31282-04-9, ≥98%, Invitrogen). Cells were split 1:5 when confluency reached 70% and discarded after passage 10 ...
-
bioRxiv - Neuroscience 2020Quote: ... mouse monoclonal anti-GOLGIN 97 CDF4 (A-21270, Thermo Fisher, RRID:AB_221447), mouse anti-Lamp1 (DSHB H4A3-c ...
-
bioRxiv - Cell Biology 2022Quote: ... Golgin-97 (CDF4, #A-21270, Thermo Fisher Scientific; IF 1:100); rabbit polyclonal antibodies to Rab4 (#ab13252 ...
-
bioRxiv - Genetics 2022Quote: ... The L-histidine (L-Histidine hydrochloride monohydrate, 98%, Acros Organics, Waltham, Massachusetts) was used at a final concentration of 0.5 mg/mL to support the growth of his-auxotrophic strains.
-
bioRxiv - Biochemistry 2021Quote: ... TAP (?) and FF (98%) were purchased from Fisher Scientific (Ward Hills, MA). ERYTH (94.8% ...
-
bioRxiv - Developmental Biology 2021Quote: ... and samples were boiled for 10 minutes at 98°C (Invitrogen, NP0007). Proteins were run on gradient pre-cast SDS polyacrylamide gels (8-16% ...
-
bioRxiv - Molecular Biology 2023Quote: To assess paraquat (Methyl viologen 98%, Thermo Fisher Scientific Cat. No.: 227320050) toxicity ...
-
bioRxiv - Genomics 2021Quote: ... purity using NanoDrop 2000 spectrophotometer (ThermoFisher Scientific), and the library size distribution on a Bioanalyzer High Sensitivity DNA chip.
-
bioRxiv - Immunology 2021Quote: ... RNA purity was tested by Qubit (ThermoFisher) and Agilent 2100 BioAnalyzer for total RNA with picogram sensitivity ...
-
bioRxiv - Microbiology 2023Quote: ... RNA purity was determined by Thermo Scientific Nanodrop 2000 by calculating an A260/A280 and A260/A230 to screen for contaminants in purified RNA ...