Labshake search
Citations for Thermo Fisher :
151 - 200 of 4628 citations for InP ZnS PEG NH2 Quantum Dots 640 nm since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... The dot blots were washed twice with 2 mL phosphate buffered saline (pH=7.4, Gibco) for 4 minutes each ...
-
bioRxiv - Developmental Biology 2023Quote: ... antibiotics were applied at a ¼ dosage and increased to final concentrations of 100µg/mL zeocin (ant-zn-1, Invitrogen), 20µg/mL blasticidin (A113903 ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Neuroscience 2021Quote: ... Nissl stain was performed by adding NeuroTrace reagent (NT 640/660, Thermofisher N21483, dilution 1:500) during the secondary antibody incubation ...
-
bioRxiv - Neuroscience 2021Quote: ... we acquired reference brain images (P28 and P10) stained with Neurotrace 640/660 (N21483, ThermoFisher Scientific). Next ...
-
bioRxiv - Neuroscience 2022Quote: ... NeuroTrace™ 640/660 deep-red fluorescent Nissl (1:200; Thermo Fisher Scientific, Cat. No. N21483) accompanied the secondary antibodies as a cytoarchitectural marker instead of NeuN.
-
bioRxiv - Cell Biology 2023Quote: ... Hybridization was performed for 17 h at 45°C in a GeneChip Hybridization Oven 640 (Affymetrix). After washing and staining in a GeneChip Fluidics Station 450 ...
-
bioRxiv - Neuroscience 2024Quote: ... the sections were incubated with Nissl/Neuro Tracer 640/660 (1:100, ThermoFisher Scientific, Cat# N21483) or species-specific secondary antibodies conjugated to 488-nm (1:500 ...
-
bioRxiv - Cell Biology 2023Quote: ... goat anti-mouse DyLight-800 4X PEG (ThermoFisher, SA5-35521) 1:10000 ...
-
bioRxiv - Bioengineering 2023Quote: ... and PLL-PEG (poly-L-Lysine) were purchased from ThermoFisher Scientific ...
-
bioRxiv - Microbiology 2024Quote: ... The plates were covered by the lid with pegs (Nunc – Transferable Solid Phase screening system (Nunc-TSP ...
-
bioRxiv - Immunology 2024Quote: ... and the PEG + virus pellet was resuspended in OptiMEM (ThermoFisher) at 1/100 of the volume of the harvest HEK supernatant ...
-
bioRxiv - Developmental Biology 2024Quote: ... The following primary antibodies were used: Zn-5 (1/200; ZIRC, University of Oregon) and GFP (1/1000; Molecular Probes). After several washes in PBT1% ...
-
bioRxiv - Neuroscience 2021Quote: ... and red F8842 beads with 505 nm/515 nm, 515 nm/534 nm, 580 nm/605 nm excitation/emission peaks; ThermoFisher) (Fig ...
-
bioRxiv - Bioengineering 2020Quote: ... for the aqueous EDC chemistry and biotinylation of NH2-MRBLEs or dimethyl sulfoxide (DMSO, Thermo Fisher Scientific) for oligonucleotide conjugation ...
-
bioRxiv - Cell Biology 2024Quote: ... AVLPQEEEGSC-NH2) was completed as previously published49 and chemiluminescent images taken using an iBright1500 (Invitrogen, Thermo Fisher). Images were analyzed using ImageJ software50 and data expressed as incident power density (IPD ...
-
bioRxiv - Cell Biology 2024Quote: ... AVLPQEEEGSC-NH2) was completed as previously published49 and chemiluminescent images taken using an iBright1500 (Invitrogen, Thermo Fisher). Images were analyzed using ImageJ software50 and data expressed as incident power density (IPD ...
-
bioRxiv - Microbiology 2020Quote: ... 1:640 and 1:1280) were made in culture medium (Minimum essential medium, MEM; Gibco, Dublin, Ireland) before mixed 1:1 with 100 TCID50 (Tissue culture infectious dosis 50 ...
-
bioRxiv - Neuroscience 2020Quote: ... Sections were then incubated in NeuroTrace 640/660 Deep-Red Fluorescent Nissl Stain (1:100, Life Technologies) for 20 minutes at room temperature and mounted with ProLong Gold Antifade Mountant with DAPI (Life Technologies).
-
bioRxiv - Neuroscience 2020Quote: ... nigral tissue sections were stained for TH and counterstained with DAPI and NeuroTrace Dye (640; Life Technologies) and imaged using a Nikon 90i upright fluorescence microscope equipped with high N.A ...
-
bioRxiv - Neuroscience 2021Quote: ... Organoids were gently diced into small chunks using a single edge razor blade (Fisher Scientific, #12-640), and then transferred to a 15 ml conical tube and pelleted to remove the PBS ...
-
bioRxiv - Cancer Biology 2020Quote: ... and Everolimus (2 nM, 10 nM, 50 nM, and 250 nM) (Fisher Scientific) for 24 hours ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... CuPT in water samples was analysed by LC-MSMS (TSQ Quantum Access Thermo Scientific). The separation was carried out on an ACME-C18 100 mm x 2.1 mm x 3.0 µm column ...
-
bioRxiv - Cell Biology 2021Quote: ... The agarase-treated samples were then carefully poured into combing reservoirs containing 1.2 ml of MES solution supplemented with 2 mM Zn(O2CCH3)2 and either S1 nuclease (40 U/ml) or S1 nuclease dilution buffer (Thermo Fisher) and were incubated for 30 min at RT ...
-
bioRxiv - Cell Biology 2020Quote: ... The samples were post-fixed using BS(PEG)5 (ThermoFisher, 21581) for 30 minutes to 1 hour to crosslink antibodies to the samples ...
-
Observation of an α-synuclein liquid droplet state and its maturation into Lewy body-like assembliesbioRxiv - Molecular Biology 2020Quote: ... 1 mM DTT and 10% polyethylene glycol (PEG) (Thermo Fisher Scientific) at 20 °C ...
-
bioRxiv - Biophysics 2021Quote: ... Methyl-PEG4-thiol (MT(PEG)4) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Biophysics 2021Quote: ... (pH 7.4) and 10% polyethylene glycol 10,000 (PEG) (Thermo Fisher Scientific) at room temperature (20-22 °C) ...
-
bioRxiv - Biophysics 2021Quote: Qdot 655 amine-derivatized polyethylene glycol (PEG) conjugates (4 µM; Invitrogen) were mixed with 50 mM Sulfo-SMCC (Thermo ...
-
bioRxiv - Microbiology 2021Quote: ... Biofilms were formed on the polystyrene pegs of MicroWell lids (Nunc), which were placed on assay plates prior to 16 h incubation with shaking ...
-
bioRxiv - Microbiology 2023Quote: Phage virions were concentrated by polyethylene glycol (PEG) 8000 (Thermo Fisher) precipitation for DNA extraction ...
-
bioRxiv - Bioengineering 2023Quote: ... and exposure to polyethylene glycol (PEG) 400 (Fisher Scientific, P167-1) for 24 h after plasma treatment by either dipping the device in the PEG 400 or only pouring 600 μL of PEG 400 into the interior of the device ...
-
bioRxiv - Bioengineering 2024Quote: ... then fixed with 10 μg/μL BS(PEG)9 (Thermo Scientific) in PBST at room temperature for 15 min ...
-
bioRxiv - Cell Biology 2024Quote: ... DyLight 800 4X PEG (SA5-35571; 1:2,000; Thermo Fisher Scientific), Goat anti-Mouse IgG (H+L ...
-
bioRxiv - Cell Biology 2024Quote: ... DyLight 800 4X PEG (SA5-35521; 1:2,000; Thermo Fisher Scientific), Goat anti-Rabbit IgG (H+L ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... nigral tissue sections were stained for TH and counterstained with DAPI and Nissl NeuroTrace Dye (640; Life Technologies) then imaged using a Nikon 90i upright fluorescence microscope equipped with high N.A ...
-
bioRxiv - Neuroscience 2023Quote: ... Sections were labeled free-floating with NeuroTrace™ 640/660 Deep-Red Fluorescent Nissl Stain (Invitrogen, Carlsbad, CA) and mounted and coverslipped using DAPI-Fluoromount-G (VWR) ...
-
bioRxiv - Bioengineering 2021Quote: ... black dots with and without VWF treatment were blocked with 10% goat serum (Life Technologies, diluted in PBS) for 1 hour and then incubated with a FITC-labeled anti-von Willebrand Factor antibody (Abcam ...
-
bioRxiv - Molecular Biology 2024Quote: ... Peptide display of EGF was verified through dot blot and ELISA using anti-EGF antibodies (Thermo Fisher Scientific). An additional self-packaging deficient variant of M13KO7 (M13SW8 ...
-
bioRxiv - Microbiology 2023Quote: ... Zn and K) were measured by High Resolution Inductively Coupled Plasma Mass Spectrometry (HR ICP-MS, Thermo Scientific, Element 2TM, Bremen, Germany) as described in Lurthy et al ...
-
bioRxiv - Biochemistry 2021Quote: ... Protein quantification was performed on a TSQ Quantum Ultra triple quadrupole mass spectrometer (Thermo Scientific) equipped with an Ultimate 3000 RSLCnano system with autosampler (Thermo Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... The MS was performed on Thermo TSQ Quantum Ultra (Thermo Fisher Scientific, Waltham, MA, USA) with an atmospheric pressure chemical ionization (APCI ...
-
bioRxiv - Biochemistry 2023Quote: ... with triple quadrupole mass spectrometer (TSQ Quantum Access Max, Thermo Fisher Scientific, Waltham, MA, USA). Separation of compounds (FKK6 ...
-
bioRxiv - Cell Biology 2024Quote: An external scan engine (Quantum Detectors) was interfaced to a Helios Hydra G5 (ThermoFisher Scientific) using the available lithography connection ...
-
bioRxiv - Molecular Biology 2020Quote: ... TetraSpeck™ beads containing four well-seprarated excitation/emission peaks (360/430 nm, 505/515 nm, 560/580 nm and 660/680 nm) (100 nm, T7284, Life Technologies) were used in a 1/10.000 dilution or fluorescently labeled EV (108 particles ...
-
bioRxiv - Biophysics 2021Quote: ... 740 nm (22 nm, Thermo Scientific) and 990 nm (30 nm ...
-
bioRxiv - Biophysics 2021Quote: ... 520 nm (16 nm, Thermo Scientific), 740 nm (22 nm ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... and β2-OtNav1.8 subunits genetically linked to NH2-terminal eGFP using Lipofectamine 3000 reagent (L3000015, Invitrogen, Carlsbad, CA, USA) as described in the manufacturer’s protocol ...
-
bioRxiv - Biophysics 2020Quote: ... followed by a second round of PEGylation with MS(PEG)4 (ThermoFisher). After assembly of a microfluidic chamber ...
-
Hypoxia-mediated suppression of pyruvate carboxylase drives tumor microenvironment immunosuppressionbioRxiv - Cancer Biology 2022Quote: ... and hybridized onto a Clariom S peg plate (Affymetrix, Santa Clara, CA). The GeneChip® WT PLUS Reagent Kit (Affymetrix ...