Labshake search
Citations for Peprotech :
1 - 50 of 710 citations for SARS CoV 2 Spike Glycoprotein S1 Sheep Fc Tag HEK293 Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2019Quote: ... 2 ng ml−1 recombinant human TGFβ1 (112 amino acid, HEK293-derived, Peprotech, 100-21). Cells were routinely maintained in E8 medium on 1:800 diluted growth factor reduced Matrigel (see below) ...
-
bioRxiv - Immunology 2021Quote: ... TGFβ1 (HEK293 derived) and TGFβ2 (HEK293 derived) were acquired from Peprotech (Rocky Hill, NJ). Primary antibody [mouse monoclonal IgG anti-Vimentin (V9)] ...
-
bioRxiv - Immunology 2022Quote: ... human IL-12p70 (HEK293) (Peprotech) and 50ng/ml recombinant human IL-18 (MBL International ...
-
bioRxiv - Immunology 2023Quote: ... 5% FCS and antibiotics supplemented with 120 U/mL IL-2 (Peprotech), 20 ng/mL IL-7 (Research grade ...
-
bioRxiv - Developmental Biology 2023Quote: ... cells were washed with PBS and further cultured for two days in S1/2 medium supplemented with FGF7 (50ng/ml) (PeproTech, 100-19) and vitamin C (0.25mM ...
-
bioRxiv - Biophysics 2023Quote: ... the cells were stimulated at 37 °C for 15 min with 2 mL of 5 nM InlB321 variant (Table S1) or 1 nM HGF (#100-39H, PeproTech, Hamburg, Germany) in serum-free DMEM-F12 ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Cancer Biology 2019Quote: ... Samples were examined by ELISA capturing with Fc-iNKG2D and detecting with biotinylated rabbit-anti-human IL-2 polyclonal antibody (Peprotech #500-P22BT) followed by incubation with streptavidin-HRP ...
-
bioRxiv - Molecular Biology 2023Quote: ... Cells were treated for 72 h with 10ng/ml recombinant human TGF-β1 (HEK293 derived, PEPROTECH). Cell density was monitored by an Incucyte S3 (Sartorius ...
-
bioRxiv - Cell Biology 2023Quote: ... containing 5% FCS and additional 100ng/mL M-CSF (PeproTech) with incubator conditions 37°C/5% CO2 ...
-
bioRxiv - Immunology 2022Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Microbiology 2020Quote: ... supplemented with 20% FCS and 2.5 ng x ml−1 GM-CSF (Peprotech). After 5-7 days ...
-
bioRxiv - Microbiology 2020Quote: ... supplemented with 20% FCS and 2.5 ng x ml-1 GM-CSF (Peprotech). After 5-7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... 10% FCS and 10 ng/ml human IL3 (Peprotech, cat no 200-03). MOLM1 ...
-
bioRxiv - Developmental Biology 2021Quote: ... and treated with 25 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 24 hours.
-
bioRxiv - Biochemistry 2021Quote: Recombinant human platelet-derived growth factor-BB (PDGF-BB) and recombinant human transforming Growth Factor-β1 (TGFβ1; HEK293 derived) were purchased from PeproTech (Hamburg, Germany) and they were dissolved in sterile ddH2O ...
-
bioRxiv - Molecular Biology 2020Quote: ... Recombinant human interleukin-2 (2 ng/ml, IL-2, Peprotech). Ficoll® lymphocyte separation medium (LSM ...
-
bioRxiv - Immunology 2023Quote: ... and 230 µL of media (RPMI with 0.5 % FCS) with human recombinant CCL21 (200ng/ml) (Peprotech) was placed in the lower chamber ...
-
bioRxiv - Immunology 2021Quote: ... Interleukin-2 (IL-2) (PeproTech 200-02) was added at a concentration of 100 U/mL during each media refresh ...
-
bioRxiv - Immunology 2022Quote: ... Interleukin-2 (IL-2) (PeproTech, 200-02) was added at a concentration of 100 U/mL during each media refresh ...
-
bioRxiv - Cancer Biology 2022Quote: ... and human interleukin-2 (hIL-2, PeproTech) at 30 U/ml ...
-
bioRxiv - Microbiology 2023Quote: ... interleukin 2 (IL-2) (50 U/ml; PeproTech), soluble anti-CD3 (0.5 μg/ml ...
-
bioRxiv - Neuroscience 2023Quote: ... and FGF-2 (Fibroblast Growth Factor-2: Peprotech). Finally ...
-
bioRxiv - Immunology 2021Quote: ... and hip bones in RPMI containing 10% FCS buffer with 10 ng/mL IL6 (Peprotech, 216-16). A red blood cell lysis step was performed in 4 mL ACK lysis buffer for 1 minute at room temperature and subsequently inactivated with 26 mL RPMI containing 10% FCS ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 5% heat-inactivated FCS (LabTech #80837) and 50 ng/ml M-CSF (PeproTech #300-25) for 7 days.
-
bioRxiv - Cell Biology 2020Quote: ... 500 μg BMP-2 (rhBMP-2, Peprotech, Hamburg, Germany) was dissolved in 1 mL of ultrapure water to form BMP-2 solution (500 μg/mL) ...
-
bioRxiv - Microbiology 2020Quote: ... Macrophages were generated from adherent cells in RPMI-1640 containing 10% FCS and M-CSF (Peprotech, 315-02) (30 ng/ml ...
-
bioRxiv - Molecular Biology 2023Quote: ... macrophages were generated from adherent cells in RPMI-1640 containing 10% FCS and M-CSF (Peprotech, 315-02) (30 ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... MD-2 (PeproTech) recombinant protein and anti-CD14 antibody (Beckman ...
-
bioRxiv - Neuroscience 2022Quote: ... EGF-2 (PeproTech), FGF (PeproTech ...
-
bioRxiv - Immunology 2020Quote: ... MD-2 (PeproTech) recombinant protein and CD14 antibody (Beckman ...
-
Hydrogen sulfide blocks HIV rebound by maintaining mitochondrial bioenergetics and redox homeostasisbioRxiv - Microbiology 2021Quote: ... 100 U/ml interleukin-2 (IL-2; Peprotech, London, United Kingdom), 1 μg/mL phytohemagglutinin (PHA ...
-
bioRxiv - Bioengineering 2021Quote: ... recombinant human fibroblast growth factor 2 (hFGF-2, Peprotech, 100-18B), recombinant human epidermal growth factor (hEGF ...
-
bioRxiv - Biophysics 2021Quote: ... the medium was replaced by RPMI containing 10% FCS and 20 ng/mL of Macrophage Colony-Stimulating Factor (M-CSF) (Peprotech). For experiments ...
-
bioRxiv - Cell Biology 2021Quote: ... the remaining one-third of the chamber was filled with complete RPMI 1640 supplemented with 10% FCS in the presence or absence of 0.6 μg/ml murine CCL19 (Peprotech, USA). The slowly diffusing CCL19-containing medium creates a CCL19 gradient that promotes BMDC migration towards the upper part of the chamber.
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Bioengineering 2021Quote: ... and fibroblast growth factor 2 (FGF-2, 5 ng mL-1; PeproTech). Cells were passaged before reaching 90% confluency and the medium was changed every 2–3 days.
-
bioRxiv - Neuroscience 2022Quote: ... and 10 ng/ml human fibroblast growth factor-2 (FGF-2, Peprotech) to synchronize the cells to the early OPC stage ...
-
bioRxiv - Bioengineering 2021Quote: ... 50IU rhIL-2 (Peprotech) and P/S ...