Labshake search
Citations for Peprotech :
1 - 50 of 1329 citations for Recombinant Rhesus monkey CD27 Fc tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Cell Biology 2023Quote: ... and rhesus interleukin 3 (IL-3)(10 ng/ml) (all Peprotech) for 2 to 3 weeks at 37°C in a humidified atmosphere with 5% CO2 ...
-
bioRxiv - Immunology 2023Quote: ... and 230 µL of media (RPMI with 0.5 % FCS) with human recombinant CCL21 (200ng/ml) (Peprotech) was placed in the lower chamber ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cancer Biology 2024Quote: ... 1% mouse recombinant EGF (Invitrogen, 5% Recombinant human R-spondin (Peprotech).
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant human cytokines (PeproTech: 100 ng/mL SCF ...
-
bioRxiv - Cancer Biology 2020Quote: ... recombinant GDNF from Peprotech.
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: Recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
bioRxiv - Immunology 2020Quote: ... Human recombinant TNF (PeproTech) was dissolved in RPMI and used at a final concentration of 10ng/mL for the indicated times ...
-
bioRxiv - Cancer Biology 2019Quote: ... recombinant human FGF2 (Peprotech) was added at concentrations ranging from 5 ng/ml to 80 ng/ml ...
-
bioRxiv - Cell Biology 2021Quote: ... human recombinant TNFα (PeproTech) was used at 50 ng/mL for 4 h ...
-
bioRxiv - Cell Biology 2023Quote: ... recombinant human BMP4 (Peprotech) was added to the culture to the final concentration 1.5 nM and then the medium was changed every third day ...
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant Human BMP7 (Peprotech) was delivered on a daily basis with a dose of 100 ug/kg/day dissolved in water for 12 days ...
-
bioRxiv - Bioengineering 2023Quote: ... human recombinant WNT1A (Peprotech) at 20ng/μl and 0.5μM LDN193189 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human BAFF (Peprotech 310-13 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL2 (Peprotech) was added at indicated concentrations.
-
bioRxiv - Developmental Biology 2023Quote: ... with recombinant cytokines (PeproTech): murine stem cell factor (SCF ...
-
bioRxiv - Cancer Biology 2023Quote: ... recombinant human TPO (PeproTech), and 10ng/ml recombinant human IL-3 (Gibco) ...
-
bioRxiv - Microbiology 2020Quote: ... recombinant human IL-10 (Peprotech) was added to the culture medium ...
-
bioRxiv - Immunology 2021Quote: ... Mouse recombinant IL-21 (PeproTech) was added to co-cultures at 10ng/ml ...
-
bioRxiv - Immunology 2019Quote: ... Recombinant human IL-2 (Peprotech) was provided at 100 U/mL ...
-
bioRxiv - Immunology 2021Quote: ... recombinant mouse IL-12 (Peprotech) and anti-IL-4 (BioXCell) ...
-
bioRxiv - Neuroscience 2021Quote: ... as human recombinant proteins (Peprotech). APOE3 was resuspended in 20 mM Sodium Phosphate ...
-
bioRxiv - Neuroscience 2021Quote: Recombinant BDNF (Peprotech, #450-02) was dissolved in sterile water containing 0.1% bovine serum albumin (BSA) ...
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant TGFβ3 10ng/ml (Peprotech); SB431542 hydrate 20μM (Sigma-Aldrich) ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant murine G-CSF (Peprotech) at 50 ng/mL was added to the culture ...
-
bioRxiv - Immunology 2022Quote: Recombinant murine IFN-γ (Peprotech) was added to a working concentration ≥500 U/mL (1:1000 from a 0.1 mg/mL stock solution ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... and recombinant murine CXCL1 (Peprotech) were mixed into the fibrinogen component ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... and recombinant murine CXCL1 (Peprotech) were diluted in 1x PBS for injection into implanted PVA sponges ...
-
bioRxiv - Immunology 2022Quote: ... human recombinant thrombopoietin (TPO) (PeproTech), human recombinant Fms-related tyrosine kinase 3 ligand (FLT3-L ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant human heregulin (HRG, PeproTech), and bafilomycin A1 were added at the indicated doses and time points ...
-
bioRxiv - Cell Biology 2020Quote: ... Recombinant TGFb (PeproTech 100-21) concentration used in stimulation was 10ng/ml.
-
bioRxiv - Immunology 2020Quote: ... Recombinant CXCL8 (Peprotech, 100ng/ml) was used as chemoattractant ...
-
bioRxiv - Molecular Biology 2019Quote: ... 10μg recombinant human LIF (Peprotech). Cells were maintained in 20% O2 conditions on irradiation inactivated mouse embryonic fibroblast (MEF ...
-
bioRxiv - Developmental Biology 2020Quote: ... 10μg recombinant human LIF (Peprotech). Cells were maintained in 20% O2 conditions on irradiation inactivated mouse embryonic fibroblast (MEF ...
-
The skin environment controls local dendritic cell differentiation and function through innate IL-13bioRxiv - Immunology 2021Quote: ... Recombinant murine IL-13 (Peprotech) was added at different times and concentrations as indicated in each experiment.
-
bioRxiv - Cell Biology 2023Quote: ... Recombinant factors (murine FGF7, Peprotech, 450-60 ...
-
bioRxiv - Immunology 2023Quote: ... 2.5µg human recombinant IL2 (Peprotech) was administered subcutaneously (s.c. ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant murine IL-4 (Peprotech); Polybrene (Millipore) ...
-
bioRxiv - Cell Biology 2023Quote: ... Recombinant TGFB1 (Peprotech 100-21) or 10 μM TGFB receptor inhibitors including SB525334 (Selleckchem S1476 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL-4 (Peprotech 200-04 ...
-
bioRxiv - Immunology 2023Quote: Recombinant human IL-2 (Peprotech 200-02 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL-21 (Peprotech 200-21 ...
-
bioRxiv - Cancer Biology 2023Quote: ... 5ug recombinant murine TNFα (Peprotech) was I.P ...