Labshake search
Citations for Peprotech :
1 - 50 of 1351 citations for Recombinant Rat Fc Fragment Of LgG Low Affinity IIb Receptor CD32 His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2020Quote: ... GDF11 (Recombinant Human/Murine/Rat GDF11, Peprotech), PD0325901 (Selleckchem) ...
-
bioRxiv - Neuroscience 2023Quote: ... recombinant rat CNTF (Peprotech; 200 ng/ml), DMAPT (Abcam ...
-
bioRxiv - Neuroscience 2023Quote: ... recombinant human/murine/rat BDNF (Peprotech, 450-02) was reconstituted in 0.1% BSA in diH2O to make 100 µg/ml BDNF stocks ...
-
bioRxiv - Immunology 2023Quote: ... in low calcium homemade culture medium containing recombinant mEGF (Peprotech) + Chelex treated FCS (see Supplementary material and 15) ...
-
bioRxiv - Immunology 2022Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Immunology 2023Quote: ... containing 10% FCS and 10ng/ml recombinant IL7 (Peprotech; 217-17), before transfer into recipient mice ...
-
bioRxiv - Neuroscience 2023Quote: Some groups received recombinant rat CNTF (Peprotech; 200 ng/ml), either solely or combined with parthenolide ...
-
bioRxiv - Neuroscience 2021Quote: ... and 50ng/mL recombinant human/murine/rat BDNF (PeproTech, #450-02) were added to slices with 3μM puromycin (Tocris #40-895-0 ...
-
bioRxiv - Physiology 2022Quote: ... and IFN (10 ng ml−1; rat recombinant; Peprotech, London, United Kingdom) to trigger their differentiation towards a pro-inflammatory phenotype M(LPS,IFN ...
-
bioRxiv - Genetics 2020Quote: ... and fresh pre-warmed media containing low dose recombinant human IL-7 (1ng/ml; Peprotech) was added to promote T cell survival without stimulation85 ...
-
bioRxiv - Neuroscience 2023Quote: ... and recombinant Human/Murine/Rat Activin A (50 ng ml−1; PeproTech, 120-14P). From day 12 ...
-
bioRxiv - Immunology 2023Quote: ... and 230 µL of media (RPMI with 0.5 % FCS) with human recombinant CCL21 (200ng/ml) (Peprotech) was placed in the lower chamber ...
-
bioRxiv - Neuroscience 2020Quote: ... and 20 ng/ml recombinant rat macrophage colony-stimulating factor (#315-02; Peprotech, NY, USA). Cells were distributed at 10 mL of suspension per petri dish (15 Petri dishes ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Neuroscience 2019Quote: ... Cells were then left unstimulated or stimulated to generate A1 polarized astrocytes by adding recombinant rat Il-1α (3 ng/mL, PeproTech, Rocky Hill, NJ), recombinant human TNFα (30 ng/mL ...
-
bioRxiv - Physiology 2022Quote: ... to trigger their differentiation towards a pro-inflammatory phenotype M(LPS,IFN) or IL4 (20 ng ml−1, rat recombinant; Peprotech, London, United Kingdom) to obtain anti-inflammatory macrophages ...
-
bioRxiv - Cancer Biology 2024Quote: ... 1% mouse recombinant EGF (Invitrogen, 5% Recombinant human R-spondin (Peprotech).
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant human cytokines (PeproTech: 100 ng/mL SCF ...
-
bioRxiv - Cancer Biology 2020Quote: ... recombinant GDNF from Peprotech.
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: Recombinant murine CCL2 (Peprotech) and recombinant murine CXCL1 (Peprotech ...
-
bioRxiv - Immunology 2020Quote: ... Human recombinant TNF (PeproTech) was dissolved in RPMI and used at a final concentration of 10ng/mL for the indicated times ...
-
bioRxiv - Cancer Biology 2019Quote: ... recombinant human FGF2 (Peprotech) was added at concentrations ranging from 5 ng/ml to 80 ng/ml ...
-
bioRxiv - Cell Biology 2021Quote: ... human recombinant TNFα (PeproTech) was used at 50 ng/mL for 4 h ...
-
bioRxiv - Cell Biology 2023Quote: ... recombinant human BMP4 (Peprotech) was added to the culture to the final concentration 1.5 nM and then the medium was changed every third day ...
-
bioRxiv - Cancer Biology 2023Quote: ... recombinant human TPO (PeproTech), and 10ng/ml recombinant human IL-3 (Gibco) ...
-
bioRxiv - Developmental Biology 2023Quote: ... with recombinant cytokines (PeproTech): murine stem cell factor (SCF ...
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant Human BMP7 (Peprotech) was delivered on a daily basis with a dose of 100 ug/kg/day dissolved in water for 12 days ...
-
bioRxiv - Bioengineering 2023Quote: ... human recombinant WNT1A (Peprotech) at 20ng/μl and 0.5μM LDN193189 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human BAFF (Peprotech 310-13 ...
-
bioRxiv - Immunology 2023Quote: ... Recombinant human IL2 (Peprotech) was added at indicated concentrations.
-
bioRxiv - Microbiology 2020Quote: ... recombinant human IL-10 (Peprotech) was added to the culture medium ...
-
bioRxiv - Immunology 2021Quote: ... Mouse recombinant IL-21 (PeproTech) was added to co-cultures at 10ng/ml ...
-
bioRxiv - Immunology 2019Quote: ... Recombinant human IL-2 (Peprotech) was provided at 100 U/mL ...
-
bioRxiv - Immunology 2021Quote: ... recombinant mouse IL-12 (Peprotech) and anti-IL-4 (BioXCell) ...
-
bioRxiv - Neuroscience 2021Quote: ... as human recombinant proteins (Peprotech). APOE3 was resuspended in 20 mM Sodium Phosphate ...
-
bioRxiv - Neuroscience 2021Quote: Recombinant BDNF (Peprotech, #450-02) was dissolved in sterile water containing 0.1% bovine serum albumin (BSA) ...
-
bioRxiv - Cancer Biology 2021Quote: ... recombinant TGFβ3 10ng/ml (Peprotech); SB431542 hydrate 20μM (Sigma-Aldrich) ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant murine G-CSF (Peprotech) at 50 ng/mL was added to the culture ...
-
bioRxiv - Immunology 2022Quote: Recombinant murine IFN-γ (Peprotech) was added to a working concentration ≥500 U/mL (1:1000 from a 0.1 mg/mL stock solution ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... and recombinant murine CXCL1 (Peprotech) were mixed into the fibrinogen component ...
-
Pulmonary infection interrupts acute cutaneous wound healing through disruption of chemokine signalsbioRxiv - Immunology 2020Quote: ... and recombinant murine CXCL1 (Peprotech) were diluted in 1x PBS for injection into implanted PVA sponges ...
-
bioRxiv - Immunology 2022Quote: ... human recombinant thrombopoietin (TPO) (PeproTech), human recombinant Fms-related tyrosine kinase 3 ligand (FLT3-L ...
-
bioRxiv - Cancer Biology 2022Quote: ... recombinant human heregulin (HRG, PeproTech), and bafilomycin A1 were added at the indicated doses and time points ...
-
bioRxiv - Cell Biology 2020Quote: ... Recombinant TGFb (PeproTech 100-21) concentration used in stimulation was 10ng/ml.
-
bioRxiv - Immunology 2020Quote: ... Recombinant CXCL8 (Peprotech, 100ng/ml) was used as chemoattractant ...